Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9086
Gene name	Eukaryotic translation initiation factor 1A Y-linked
Gene symbol	EIF1AY
Synonyms (NCBI Gene)	eIF-4C
Chromosome	Y
Chromosome location	Yq11.223
Summary	This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits.

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029071	hsa-miR-26b-5p	Microarray	19088304
MIRT956306	hsa-miR-3160-5p	CLIP-seq
MIRT956307	hsa-miR-329	CLIP-seq
MIRT956308	hsa-miR-362-3p	CLIP-seq
MIRT956309	hsa-miR-3920	CLIP-seq
MIRT956310	hsa-miR-3941	CLIP-seq
MIRT956311	hsa-miR-3942-3p	CLIP-seq
MIRT956312	hsa-miR-4762-3p	CLIP-seq
MIRT956313	hsa-miR-4799-5p	CLIP-seq
MIRT956314	hsa-miR-494	CLIP-seq
MIRT956315	hsa-miR-548u	CLIP-seq
MIRT956316	hsa-miR-570	CLIP-seq
MIRT956317	hsa-miR-603	CLIP-seq
MIRT1983208	hsa-miR-4795-3p	CLIP-seq
MIRT2218455	hsa-miR-3120-5p	CLIP-seq
MIRT2218456	hsa-miR-338-3p	CLIP-seq
MIRT2218457	hsa-miR-361-5p	CLIP-seq
MIRT2218458	hsa-miR-3671	CLIP-seq
MIRT2218459	hsa-miR-3682-3p	CLIP-seq
MIRT2218460	hsa-miR-4652-3p	CLIP-seq
MIRT956313	hsa-miR-4799-5p	CLIP-seq
MIRT2218461	hsa-miR-563	CLIP-seq
MIRT2218462	hsa-miR-607	CLIP-seq
MIRT2387311	hsa-miR-1236	CLIP-seq
MIRT2218459	hsa-miR-3682-3p	CLIP-seq
MIRT2387312	hsa-miR-4753-3p	CLIP-seq
MIRT2387313	hsa-miR-4768-5p	CLIP-seq
MIRT2387314	hsa-miR-4778-3p	CLIP-seq
MIRT2218461	hsa-miR-563	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16713569, 25910212, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IEA

MIM	HGNC	e!Ensembl
400014	3252	ENSG00000198692

O14602

Protein name

Eukaryotic translation initiation factor 1A, Y-chromosomal (eIF-1A Y isoform) (eIF1A Y isoform) (Eukaryotic translation initiation factor 4C) (eIF-4C)

Protein function

Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon. This protein enhances formation of the cap-proximal complex. Together with E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01176	eIF-1a	32 → 94	Translation initiation factor 1A / IF-1	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCH
IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
FGPGDDDEIQFDDIGDDDEDIDDI

Sequence length

144

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37833700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	16936303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	12057908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	36688193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35346191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24741625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32788627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF1AY (eukaryotic translation initiation factor 1A Y-linked)