Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	908
Gene name	Chaperonin containing TCP1 subunit 6A
Gene symbol	CCT6A
Synonyms (NCBI Gene)	CCT-zetaCCT-zeta-1CCT6CctzHTR3MoDP-2TCP-1-zetaTCP20TCPZTTCP20
Chromosome	7
Chromosome location	7p11.2
Summary	The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p

359

Show/Hide all (359)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028359	hsa-miR-32-5p	Sequencing	20371350
MIRT050996	hsa-miR-17-5p	CLASH	23622248
MIRT050689	hsa-miR-18a-5p	CLASH	23622248
MIRT045502	hsa-miR-149-5p	CLASH	23622248
MIRT045101	hsa-miR-186-5p	CLASH	23622248
MIRT044158	hsa-miR-30e-5p	CLASH	23622248
MIRT042874	hsa-miR-324-3p	CLASH	23622248
MIRT052868	hsa-miR-3663-3p	CLASH	23622248
MIRT222274	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT222273	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT222271	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT222280	hsa-miR-4295	PAR-CLIP	21572407
MIRT222278	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT222279	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT222281	hsa-miR-3666	PAR-CLIP	21572407
MIRT222272	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT222270	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT222275	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT558875	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT558874	hsa-miR-8084	PAR-CLIP	21572407
MIRT558873	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT222282	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT558872	hsa-miR-4276	PAR-CLIP	21572407
MIRT531532	hsa-miR-892c-5p	PAR-CLIP	22012620
MIRT531531	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT531530	hsa-miR-5100	PAR-CLIP	22012620
MIRT531529	hsa-miR-455-3p	PAR-CLIP	22012620
MIRT531528	hsa-miR-3942-3p	PAR-CLIP	22012620
MIRT258457	hsa-miR-6516-5p	PAR-CLIP	22012620
MIRT531528	hsa-miR-3942-3p	PAR-CLIP	26701625
MIRT531529	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT531530	hsa-miR-5100	PAR-CLIP	26701625
MIRT258457	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT531531	hsa-miR-676-5p	PAR-CLIP	26701625
MIRT531532	hsa-miR-892c-5p	PAR-CLIP	26701625
MIRT222274	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT222273	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT222271	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT222280	hsa-miR-4295	PAR-CLIP	21572407
MIRT222278	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT222279	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT222281	hsa-miR-3666	PAR-CLIP	21572407
MIRT222272	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT222270	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT222275	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT558875	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT558874	hsa-miR-8084	PAR-CLIP	21572407
MIRT558873	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT222282	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT558872	hsa-miR-4276	PAR-CLIP	21572407
MIRT531532	hsa-miR-892c-5p	PAR-CLIP	22012620
MIRT531531	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT531530	hsa-miR-5100	PAR-CLIP	22012620
MIRT531529	hsa-miR-455-3p	PAR-CLIP	22012620
MIRT531528	hsa-miR-3942-3p	PAR-CLIP	22012620
MIRT258457	hsa-miR-6516-5p	PAR-CLIP	22012620
MIRT873520	hsa-miR-1243	CLIP-seq
MIRT873521	hsa-miR-1261	CLIP-seq
MIRT873522	hsa-miR-1288	CLIP-seq
MIRT873523	hsa-miR-1305	CLIP-seq
MIRT873524	hsa-miR-130a	CLIP-seq
MIRT873525	hsa-miR-130b	CLIP-seq
MIRT873526	hsa-miR-137	CLIP-seq
MIRT873527	hsa-miR-148a	CLIP-seq
MIRT873528	hsa-miR-148b	CLIP-seq
MIRT873529	hsa-miR-152	CLIP-seq
MIRT873530	hsa-miR-1972	CLIP-seq
MIRT873531	hsa-miR-199a-5p	CLIP-seq
MIRT873532	hsa-miR-199b-5p	CLIP-seq
MIRT873533	hsa-miR-2117	CLIP-seq
MIRT738184	hsa-miR-216a	CLIP-seq
MIRT873534	hsa-miR-216b	CLIP-seq
MIRT873535	hsa-miR-2467-3p	CLIP-seq
MIRT873536	hsa-miR-25	CLIP-seq
MIRT873537	hsa-miR-301a	CLIP-seq
MIRT873538	hsa-miR-301b	CLIP-seq
MIRT873539	hsa-miR-3143	CLIP-seq
MIRT873540	hsa-miR-3152-5p	CLIP-seq
MIRT873541	hsa-miR-3153	CLIP-seq
MIRT873542	hsa-miR-3158-5p	CLIP-seq
MIRT873543	hsa-miR-3169	CLIP-seq
MIRT873544	hsa-miR-32	CLIP-seq
MIRT873545	hsa-miR-363	CLIP-seq
MIRT873546	hsa-miR-3647-3p	CLIP-seq
MIRT873547	hsa-miR-3664-3p	CLIP-seq
MIRT873548	hsa-miR-367	CLIP-seq
MIRT873549	hsa-miR-3678-3p	CLIP-seq
MIRT873550	hsa-miR-3680	CLIP-seq
MIRT873551	hsa-miR-410	CLIP-seq
MIRT873552	hsa-miR-412	CLIP-seq
MIRT873553	hsa-miR-421	CLIP-seq
MIRT873554	hsa-miR-4252	CLIP-seq
MIRT873555	hsa-miR-4255	CLIP-seq
MIRT873556	hsa-miR-4261	CLIP-seq
MIRT873557	hsa-miR-4273	CLIP-seq
MIRT873558	hsa-miR-4282	CLIP-seq
MIRT873559	hsa-miR-4418	CLIP-seq
MIRT873560	hsa-miR-4420	CLIP-seq
MIRT873561	hsa-miR-4422	CLIP-seq
MIRT873562	hsa-miR-454	CLIP-seq
MIRT873563	hsa-miR-4650-5p	CLIP-seq
MIRT873564	hsa-miR-4668-5p	CLIP-seq
MIRT873565	hsa-miR-4709-5p	CLIP-seq
MIRT873566	hsa-miR-4717-5p	CLIP-seq
MIRT873567	hsa-miR-4729	CLIP-seq
MIRT873568	hsa-miR-4756-3p	CLIP-seq
MIRT873569	hsa-miR-4768-5p	CLIP-seq
MIRT873570	hsa-miR-4774-3p	CLIP-seq
MIRT873571	hsa-miR-4793-5p	CLIP-seq
MIRT873572	hsa-miR-4802-3p	CLIP-seq
MIRT873573	hsa-miR-509-3-5p	CLIP-seq
MIRT873574	hsa-miR-509-5p	CLIP-seq
MIRT738181	hsa-miR-513a-3p	CLIP-seq
MIRT873575	hsa-miR-543	CLIP-seq
MIRT873576	hsa-miR-548p	CLIP-seq
MIRT873577	hsa-miR-590-3p	CLIP-seq
MIRT873578	hsa-miR-628-3p	CLIP-seq
MIRT873579	hsa-miR-668	CLIP-seq
MIRT873580	hsa-miR-802	CLIP-seq
MIRT873581	hsa-miR-92a	CLIP-seq
MIRT873582	hsa-miR-92b	CLIP-seq
MIRT873520	hsa-miR-1243	CLIP-seq
MIRT873521	hsa-miR-1261	CLIP-seq
MIRT873522	hsa-miR-1288	CLIP-seq
MIRT873524	hsa-miR-130a	CLIP-seq
MIRT873525	hsa-miR-130b	CLIP-seq
MIRT873527	hsa-miR-148a	CLIP-seq
MIRT873528	hsa-miR-148b	CLIP-seq
MIRT873529	hsa-miR-152	CLIP-seq
MIRT873535	hsa-miR-2467-3p	CLIP-seq
MIRT873537	hsa-miR-301a	CLIP-seq
MIRT873538	hsa-miR-301b	CLIP-seq
MIRT873542	hsa-miR-3158-5p	CLIP-seq
MIRT873543	hsa-miR-3169	CLIP-seq
MIRT873546	hsa-miR-3647-3p	CLIP-seq
MIRT873549	hsa-miR-3678-3p	CLIP-seq
MIRT1959136	hsa-miR-3913-3p	CLIP-seq
MIRT873552	hsa-miR-412	CLIP-seq
MIRT873559	hsa-miR-4418	CLIP-seq
MIRT873560	hsa-miR-4420	CLIP-seq
MIRT873561	hsa-miR-4422	CLIP-seq
MIRT1959137	hsa-miR-4484	CLIP-seq
MIRT1959138	hsa-miR-450a	CLIP-seq
MIRT873562	hsa-miR-454	CLIP-seq
MIRT1959139	hsa-miR-4733-5p	CLIP-seq
MIRT873568	hsa-miR-4756-3p	CLIP-seq
MIRT873571	hsa-miR-4793-5p	CLIP-seq
MIRT873572	hsa-miR-4802-3p	CLIP-seq
MIRT1959140	hsa-miR-4803	CLIP-seq
MIRT1959141	hsa-miR-489	CLIP-seq
MIRT873573	hsa-miR-509-3-5p	CLIP-seq
MIRT873574	hsa-miR-509-5p	CLIP-seq
MIRT1959142	hsa-miR-548ag	CLIP-seq
MIRT1959143	hsa-miR-548ai	CLIP-seq
MIRT873576	hsa-miR-548p	CLIP-seq
MIRT873577	hsa-miR-590-3p	CLIP-seq
MIRT1959144	hsa-miR-624	CLIP-seq
MIRT873578	hsa-miR-628-3p	CLIP-seq
MIRT1959145	hsa-miR-628-5p	CLIP-seq
MIRT873579	hsa-miR-668	CLIP-seq
MIRT873580	hsa-miR-802	CLIP-seq
MIRT738172	hsa-miR-1228	CLIP-seq
MIRT873520	hsa-miR-1243	CLIP-seq
MIRT873521	hsa-miR-1261	CLIP-seq
MIRT2196070	hsa-miR-127-5p	CLIP-seq
MIRT873522	hsa-miR-1288	CLIP-seq
MIRT873523	hsa-miR-1305	CLIP-seq
MIRT873524	hsa-miR-130a	CLIP-seq
MIRT873525	hsa-miR-130b	CLIP-seq
MIRT873526	hsa-miR-137	CLIP-seq
MIRT873527	hsa-miR-148a	CLIP-seq
MIRT873528	hsa-miR-148b	CLIP-seq
MIRT873529	hsa-miR-152	CLIP-seq
MIRT738173	hsa-miR-197	CLIP-seq
MIRT873530	hsa-miR-1972	CLIP-seq
MIRT873531	hsa-miR-199a-5p	CLIP-seq
MIRT873532	hsa-miR-199b-5p	CLIP-seq
MIRT873533	hsa-miR-2117	CLIP-seq
MIRT738184	hsa-miR-216a	CLIP-seq
MIRT873535	hsa-miR-2467-3p	CLIP-seq
MIRT873536	hsa-miR-25	CLIP-seq
MIRT873537	hsa-miR-301a	CLIP-seq
MIRT873538	hsa-miR-301b	CLIP-seq
MIRT2196071	hsa-miR-3125	CLIP-seq
MIRT873539	hsa-miR-3143	CLIP-seq
MIRT2196072	hsa-miR-3144-3p	CLIP-seq
MIRT873540	hsa-miR-3152-5p	CLIP-seq
MIRT873542	hsa-miR-3158-5p	CLIP-seq
MIRT2196073	hsa-miR-3160-5p	CLIP-seq
MIRT873543	hsa-miR-3169	CLIP-seq
MIRT873544	hsa-miR-32	CLIP-seq
MIRT873545	hsa-miR-363	CLIP-seq
MIRT873547	hsa-miR-3664-3p	CLIP-seq
MIRT873548	hsa-miR-367	CLIP-seq
MIRT873549	hsa-miR-3678-3p	CLIP-seq
MIRT873550	hsa-miR-3680	CLIP-seq
MIRT2196074	hsa-miR-3692	CLIP-seq
MIRT738182	hsa-miR-371-5p	CLIP-seq
MIRT738183	hsa-miR-371b-5p	CLIP-seq
MIRT1959136	hsa-miR-3913-3p	CLIP-seq
MIRT2196075	hsa-miR-3916	CLIP-seq
MIRT2196076	hsa-miR-3973	CLIP-seq
MIRT873551	hsa-miR-410	CLIP-seq
MIRT873552	hsa-miR-412	CLIP-seq
MIRT873553	hsa-miR-421	CLIP-seq
MIRT873554	hsa-miR-4252	CLIP-seq
MIRT873555	hsa-miR-4255	CLIP-seq
MIRT873557	hsa-miR-4273	CLIP-seq
MIRT873558	hsa-miR-4282	CLIP-seq
MIRT873559	hsa-miR-4418	CLIP-seq
MIRT873560	hsa-miR-4420	CLIP-seq
MIRT873561	hsa-miR-4422	CLIP-seq
MIRT2196077	hsa-miR-4453	CLIP-seq
MIRT1959137	hsa-miR-4484	CLIP-seq
MIRT2196078	hsa-miR-4520a-3p	CLIP-seq
MIRT2196079	hsa-miR-4520b-3p	CLIP-seq
MIRT2196080	hsa-miR-4538	CLIP-seq
MIRT873562	hsa-miR-454	CLIP-seq
MIRT873563	hsa-miR-4650-5p	CLIP-seq
MIRT2196081	hsa-miR-4699-3p	CLIP-seq
MIRT873565	hsa-miR-4709-5p	CLIP-seq
MIRT738185	hsa-miR-4715-5p	CLIP-seq
MIRT873566	hsa-miR-4717-5p	CLIP-seq
MIRT873567	hsa-miR-4729	CLIP-seq
MIRT1959139	hsa-miR-4733-5p	CLIP-seq
MIRT873568	hsa-miR-4756-3p	CLIP-seq
MIRT2196082	hsa-miR-4766-3p	CLIP-seq
MIRT873570	hsa-miR-4774-3p	CLIP-seq
MIRT873571	hsa-miR-4793-5p	CLIP-seq
MIRT2196083	hsa-miR-4797-5p	CLIP-seq
MIRT1959141	hsa-miR-489	CLIP-seq
MIRT2196084	hsa-miR-500a	CLIP-seq
MIRT873573	hsa-miR-509-3-5p	CLIP-seq
MIRT873574	hsa-miR-509-5p	CLIP-seq
MIRT738180	hsa-miR-5096	CLIP-seq
MIRT2196085	hsa-miR-510	CLIP-seq
MIRT2196086	hsa-miR-512-5p	CLIP-seq
MIRT738181	hsa-miR-513a-3p	CLIP-seq
MIRT2196087	hsa-miR-520g	CLIP-seq
MIRT2196088	hsa-miR-520h	CLIP-seq
MIRT873575	hsa-miR-543	CLIP-seq
MIRT873576	hsa-miR-548p	CLIP-seq
MIRT2196089	hsa-miR-586	CLIP-seq
MIRT2196090	hsa-miR-607	CLIP-seq
MIRT873578	hsa-miR-628-3p	CLIP-seq
MIRT2196091	hsa-miR-640	CLIP-seq
MIRT873579	hsa-miR-668	CLIP-seq
MIRT873580	hsa-miR-802	CLIP-seq
MIRT873581	hsa-miR-92a	CLIP-seq
MIRT873582	hsa-miR-92b	CLIP-seq
MIRT738174	hsa-miR-938	CLIP-seq
MIRT2196092	hsa-miR-944	CLIP-seq
MIRT873520	hsa-miR-1243	CLIP-seq
MIRT873521	hsa-miR-1261	CLIP-seq
MIRT873560	hsa-miR-4420	CLIP-seq
MIRT873576	hsa-miR-548p	CLIP-seq
MIRT2499134	hsa-miR-105	CLIP-seq
MIRT2499135	hsa-miR-1236	CLIP-seq
MIRT2499136	hsa-miR-1262	CLIP-seq
MIRT873522	hsa-miR-1288	CLIP-seq
MIRT2499137	hsa-miR-1908	CLIP-seq
MIRT738184	hsa-miR-216a	CLIP-seq
MIRT873534	hsa-miR-216b	CLIP-seq
MIRT873535	hsa-miR-2467-3p	CLIP-seq
MIRT2196072	hsa-miR-3144-3p	CLIP-seq
MIRT873542	hsa-miR-3158-5p	CLIP-seq
MIRT2196073	hsa-miR-3160-5p	CLIP-seq
MIRT873543	hsa-miR-3169	CLIP-seq
MIRT873549	hsa-miR-3678-3p	CLIP-seq
MIRT2499138	hsa-miR-3685	CLIP-seq
MIRT2499139	hsa-miR-384	CLIP-seq
MIRT1959136	hsa-miR-3913-3p	CLIP-seq
MIRT873551	hsa-miR-410	CLIP-seq
MIRT873552	hsa-miR-412	CLIP-seq
MIRT873556	hsa-miR-4261	CLIP-seq
MIRT873558	hsa-miR-4282	CLIP-seq
MIRT873559	hsa-miR-4418	CLIP-seq
MIRT2499140	hsa-miR-4474-3p	CLIP-seq
MIRT1959137	hsa-miR-4484	CLIP-seq
MIRT2499141	hsa-miR-4517	CLIP-seq
MIRT2196081	hsa-miR-4699-3p	CLIP-seq
MIRT2499142	hsa-miR-4701-3p	CLIP-seq
MIRT2499143	hsa-miR-4720-3p	CLIP-seq
MIRT873567	hsa-miR-4729	CLIP-seq
MIRT1959139	hsa-miR-4733-5p	CLIP-seq
MIRT873568	hsa-miR-4756-3p	CLIP-seq
MIRT2196082	hsa-miR-4766-3p	CLIP-seq
MIRT2499144	hsa-miR-4804-3p	CLIP-seq
MIRT1959141	hsa-miR-489	CLIP-seq
MIRT873573	hsa-miR-509-3-5p	CLIP-seq
MIRT873574	hsa-miR-509-5p	CLIP-seq
MIRT2196085	hsa-miR-510	CLIP-seq
MIRT2196086	hsa-miR-512-5p	CLIP-seq
MIRT2499145	hsa-miR-539	CLIP-seq
MIRT2499146	hsa-miR-548aa	CLIP-seq
MIRT873576	hsa-miR-548p	CLIP-seq
MIRT2196089	hsa-miR-586	CLIP-seq
MIRT873577	hsa-miR-590-3p	CLIP-seq
MIRT2196090	hsa-miR-607	CLIP-seq
MIRT873578	hsa-miR-628-3p	CLIP-seq
MIRT2196091	hsa-miR-640	CLIP-seq
MIRT2499147	hsa-miR-656	CLIP-seq
MIRT2499148	hsa-miR-663	CLIP-seq
MIRT873580	hsa-miR-802	CLIP-seq
MIRT2499134	hsa-miR-105	CLIP-seq
MIRT2499135	hsa-miR-1236	CLIP-seq
MIRT2499136	hsa-miR-1262	CLIP-seq
MIRT873522	hsa-miR-1288	CLIP-seq
MIRT2499137	hsa-miR-1908	CLIP-seq
MIRT738184	hsa-miR-216a	CLIP-seq
MIRT873534	hsa-miR-216b	CLIP-seq
MIRT873535	hsa-miR-2467-3p	CLIP-seq
MIRT2196072	hsa-miR-3144-3p	CLIP-seq
MIRT873540	hsa-miR-3152-5p	CLIP-seq
MIRT873542	hsa-miR-3158-5p	CLIP-seq
MIRT2196073	hsa-miR-3160-5p	CLIP-seq
MIRT873543	hsa-miR-3169	CLIP-seq
MIRT873546	hsa-miR-3647-3p	CLIP-seq
MIRT873549	hsa-miR-3678-3p	CLIP-seq
MIRT2499138	hsa-miR-3685	CLIP-seq
MIRT738182	hsa-miR-371-5p	CLIP-seq
MIRT738183	hsa-miR-371b-5p	CLIP-seq
MIRT2499139	hsa-miR-384	CLIP-seq
MIRT1959136	hsa-miR-3913-3p	CLIP-seq
MIRT873551	hsa-miR-410	CLIP-seq
MIRT873552	hsa-miR-412	CLIP-seq
MIRT873556	hsa-miR-4261	CLIP-seq
MIRT873558	hsa-miR-4282	CLIP-seq
MIRT873559	hsa-miR-4418	CLIP-seq
MIRT2499140	hsa-miR-4474-3p	CLIP-seq
MIRT1959138	hsa-miR-450a	CLIP-seq
MIRT2196081	hsa-miR-4699-3p	CLIP-seq
MIRT2499142	hsa-miR-4701-3p	CLIP-seq
MIRT738185	hsa-miR-4715-5p	CLIP-seq
MIRT2499143	hsa-miR-4720-3p	CLIP-seq
MIRT873567	hsa-miR-4729	CLIP-seq
MIRT1959139	hsa-miR-4733-5p	CLIP-seq
MIRT873568	hsa-miR-4756-3p	CLIP-seq
MIRT2196082	hsa-miR-4766-3p	CLIP-seq
MIRT873570	hsa-miR-4774-3p	CLIP-seq
MIRT2499144	hsa-miR-4804-3p	CLIP-seq
MIRT1959141	hsa-miR-489	CLIP-seq
MIRT873573	hsa-miR-509-3-5p	CLIP-seq
MIRT873574	hsa-miR-509-5p	CLIP-seq
MIRT738180	hsa-miR-5096	CLIP-seq
MIRT2196085	hsa-miR-510	CLIP-seq
MIRT2196086	hsa-miR-512-5p	CLIP-seq
MIRT738181	hsa-miR-513a-3p	CLIP-seq
MIRT2499146	hsa-miR-548aa	CLIP-seq
MIRT873576	hsa-miR-548p	CLIP-seq
MIRT738186	hsa-miR-582-5p	CLIP-seq
MIRT2196089	hsa-miR-586	CLIP-seq
MIRT873577	hsa-miR-590-3p	CLIP-seq
MIRT2196090	hsa-miR-607	CLIP-seq
MIRT873578	hsa-miR-628-3p	CLIP-seq
MIRT2196091	hsa-miR-640	CLIP-seq
MIRT2499147	hsa-miR-656	CLIP-seq
MIRT2499148	hsa-miR-663	CLIP-seq
MIRT873580	hsa-miR-802	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	14532270, 17500595, 30021884, 32296183, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8034610
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005832	Component	Chaperonin-containing T-complex	IBA
GO:0005832	Component	Chaperonin-containing T-complex	IDA	23011926, 30955883
GO:0005832	Component	Chaperonin-containing T-complex	IEA
GO:0005832	Component	Chaperonin-containing T-complex	IPI	22133715
GO:0005832	Component	Chaperonin-containing T-complex	TAS	25467444
GO:0005874	Component	Microtubule	IDA	21525035
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	22133715, 30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	IMP	25467444
GO:0006457	Process	Protein folding	TAS	8034610
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	25467444
GO:0044183	Function	Protein folding chaperone	IDA	25467444, 30955883
GO:0044183	Function	Protein folding chaperone	IEA
GO:0050821	Process	Protein stabilization	IMP	25467444
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	TAS	8034610
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071987	Function	WD40-repeat domain binding	IPI	25467444
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1904851	Process	Positive regulation of establishment of protein localization to telomere	IMP	25467444
GO:1904871	Process	Positive regulation of protein localization to Cajal body	HMP	25467444
GO:1904874	Process	Positive regulation of telomerase RNA localization to Cajal body	HMP	25467444

MIM	HGNC	e!Ensembl
104613	1620	ENSG00000146731

P40227

Protein name

T-complex protein 1 subunit zeta (TCP-1-zeta) (EC 3.6.1.-) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (Chaperonin containing T-complex polypeptide 1 subunit 6A) (HTR3) (Tcp20)

Protein function

Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of actin, tubulin and other proteins upon ATP hydrolysis (PubMed:25467444, PubMed:36493755, PubMed:35449234, PubMed:37193829). The TR

PDB

6NR8 , 6NR9 , 6NRA , 6NRB , 6NRC , 6NRD , 6QB8 , 7LUM , 7LUP , 7NVL , 7NVM , 7NVN , 7NVO , 7TRG , 7TTN , 7TTT , 7TUB , 7WU7 , 7WZ3 , 7X0A , 7X0S , 7X0V , 7X3J , 7X3U , 7X6Q , 7X7Y , 8HKI , 8I1U , 8I9U , 8IB8 , 8SFE , 8SFF , 8SG8 , 8SG9 , 8SGC , 8SGL , 8SGQ , 8SH9 , 8SHA , 8SHD , 8SHE , 8SHF , 8SHG , 8SHL , 8SHN , 8SHO , 8SHP , 8SHQ , 8SHT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00118	Cpn60_TCP1	30 → 526	TCP-1/cpn60 chaperonin family	Family

Sequence

MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG
NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT
EGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIK
KQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYE
KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPF
SLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKF
TFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVD
LNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG

Sequence length

531

Interactions

View interactions

	Reactome
			Association of TriC/CCT with target proteins during biosynthesis Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27489109	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	34312925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27489109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27489109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30942452, 31101846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30942452, 31101846, 37190091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34500119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30942452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	31465112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20872946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34434188, 35315492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	23126479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30451371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30451371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36870568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31819524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30942452	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27489109	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27489109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32631353, 34196992	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30942452, 31101846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30942452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30942452, 31819524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20872946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27616601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36584147	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34434188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	33530265	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	40156427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20168265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16211299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38084868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35838025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37190091	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34196992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CCT6A (chaperonin containing TCP1 subunit 6A)