Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9079
Gene name	LIM domain binding 2
Gene symbol	LDB2
Synonyms (NCBI Gene)	CLIM1LDB-2LDB1
Chromosome	4
Chromosome location	4p15.32
Summary	The protein encoded by this gene belongs to the LIM-domain binding family. Members of this family are characterized by a conserved nuclear localization sequence, an amino-terminal homodimerization domain and a carboxy-terminal LIM interaction domain. Thes

134

Show/Hide all (134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030241	hsa-miR-26b-5p	Microarray	19088304
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT609694	hsa-miR-3169	HITS-CLIP	23824327
MIRT609693	hsa-miR-4515	HITS-CLIP	23824327
MIRT609692	hsa-miR-7154-3p	HITS-CLIP	23824327
MIRT1106236	hsa-miR-1246	CLIP-seq
MIRT1106237	hsa-miR-3127-5p	CLIP-seq
MIRT1106238	hsa-miR-3148	CLIP-seq
MIRT1106239	hsa-miR-3150b-3p	CLIP-seq
MIRT1106240	hsa-miR-3688-3p	CLIP-seq
MIRT1106241	hsa-miR-3918	CLIP-seq
MIRT1106242	hsa-miR-3921	CLIP-seq
MIRT1106243	hsa-miR-3928	CLIP-seq
MIRT1106244	hsa-miR-4517	CLIP-seq
MIRT1106245	hsa-miR-4649-3p	CLIP-seq
MIRT1106246	hsa-miR-4653-5p	CLIP-seq
MIRT1106247	hsa-miR-4689	CLIP-seq
MIRT1106248	hsa-miR-4694-3p	CLIP-seq
MIRT1106249	hsa-miR-4784	CLIP-seq
MIRT1106250	hsa-miR-548aa	CLIP-seq
MIRT1106251	hsa-miR-548g	CLIP-seq
MIRT1106252	hsa-miR-889	CLIP-seq
MIRT2029398	hsa-miR-511	CLIP-seq
MIRT2029399	hsa-miR-561	CLIP-seq
MIRT2260262	hsa-miR-3611	CLIP-seq
MIRT2260263	hsa-miR-421	CLIP-seq
MIRT2260264	hsa-miR-4493	CLIP-seq
MIRT2260262	hsa-miR-3611	CLIP-seq
MIRT2260264	hsa-miR-4493	CLIP-seq
MIRT2452900	hsa-miR-4742-3p	CLIP-seq
MIRT2452901	hsa-miR-556-3p	CLIP-seq
MIRT2560431	hsa-miR-338-5p	CLIP-seq
MIRT2260262	hsa-miR-3611	CLIP-seq
MIRT2260264	hsa-miR-4493	CLIP-seq
MIRT2452900	hsa-miR-4742-3p	CLIP-seq
MIRT2452901	hsa-miR-556-3p	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0001942	Process	Hair follicle development	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	TAS	9880598
GO:0005515	Function	Protein binding	IPI	15231748, 18330356, 20211142, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9853615
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0007399	Process	Nervous system development	IBA
GO:0010669	Process	Epithelial structure maintenance	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0030274	Function	LIM domain binding	ISS
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030334	Process	Regulation of cell migration	ISS
GO:0031252	Component	Cell leading edge	IEA
GO:0031252	Component	Cell leading edge	ISS
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0043549	Process	Regulation of kinase activity	ISS
GO:0044089	Process	Positive regulation of cellular component biogenesis	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA

MIM	HGNC	e!Ensembl
603450	6533	ENSG00000169744

O43679

Protein name

LIM domain-binding protein 2 (LDB-2) (Carboxyl-terminal LIM domain-binding protein 1) (CLIM-1) (LIM domain-binding factor CLIM1)

Protein function

Transcription cofactor. Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01803	LIM_bind	30 → 186	LIM-domain binding protein	Family
PF01803	LIM_bind	175 → 232	LIM-domain binding protein	Family
PF17916	LID	298 → 326	LIM interaction domain (LID)	Domain

Sequence

MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFE
DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDC
DQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQD
PQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQ
RMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVM
VVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQ
ETKSENPPPQASQ

Sequence length

373

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEGMATOGENOUS RETINAL DETACHMENT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	9872335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASDB_DG	19836008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12771919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	27405777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19997623, 24925974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19997623, 24925974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12771919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27713177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27713177, 37794510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	38091987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19997623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19997623, 24925974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19997623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	38091987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	33114701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35805116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25079073	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	35881062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12792813		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26598604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26598604, 32229578, 37573405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32229578, 37573405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	26598604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29212240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36473369	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30327200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29212240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31022553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	12792813, 17316599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27713177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28009534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35881062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29278703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	BEFREE	31573454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	35845940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12771919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12771919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LDB2 (LIM domain binding 2)