Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9061
Gene name	3'-phosphoadenosine 5'-phosphosulfate synthase 1
Gene symbol	PAPSS1
Synonyms (NCBI Gene)	ATPSK1PAPSSSK1
Chromosome	4
Chromosome location	4q25
Summary	Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, inc

149

Show/Hide all (149)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032474	hsa-let-7b-5p	Proteomics	18668040
MIRT048587	hsa-miR-100-5p	CLASH	23622248
MIRT1213186	hsa-miR-299-3p	CLIP-seq
MIRT1213187	hsa-miR-3152-3p	CLIP-seq
MIRT1213188	hsa-miR-323-3p	CLIP-seq
MIRT1213189	hsa-miR-3613-3p	CLIP-seq
MIRT1213190	hsa-miR-3653	CLIP-seq
MIRT1213191	hsa-miR-369-3p	CLIP-seq
MIRT1213192	hsa-miR-374a	CLIP-seq
MIRT1213193	hsa-miR-374b	CLIP-seq
MIRT1213194	hsa-miR-3923	CLIP-seq
MIRT1213195	hsa-miR-425	CLIP-seq
MIRT1213196	hsa-miR-4281	CLIP-seq
MIRT1213197	hsa-miR-4302	CLIP-seq
MIRT1213198	hsa-miR-4461	CLIP-seq
MIRT1213199	hsa-miR-4491	CLIP-seq
MIRT1213200	hsa-miR-4657	CLIP-seq
MIRT1213201	hsa-miR-4775	CLIP-seq
MIRT1213202	hsa-miR-4786-3p	CLIP-seq
MIRT1213203	hsa-miR-548aa	CLIP-seq
MIRT1213204	hsa-miR-548c-3p	CLIP-seq
MIRT1213205	hsa-miR-590-3p	CLIP-seq
MIRT1213206	hsa-miR-592	CLIP-seq
MIRT1213207	hsa-miR-597	CLIP-seq
MIRT1213208	hsa-miR-628-3p	CLIP-seq
MIRT1213209	hsa-miR-642b	CLIP-seq
MIRT2061307	hsa-miR-1324	CLIP-seq
MIRT1213186	hsa-miR-299-3p	CLIP-seq
MIRT2061308	hsa-miR-3163	CLIP-seq
MIRT1213191	hsa-miR-369-3p	CLIP-seq
MIRT1213192	hsa-miR-374a	CLIP-seq
MIRT1213193	hsa-miR-374b	CLIP-seq
MIRT1213194	hsa-miR-3923	CLIP-seq
MIRT1213196	hsa-miR-4281	CLIP-seq
MIRT1213199	hsa-miR-4491	CLIP-seq
MIRT1213200	hsa-miR-4657	CLIP-seq
MIRT1213205	hsa-miR-590-3p	CLIP-seq
MIRT1213206	hsa-miR-592	CLIP-seq
MIRT1213207	hsa-miR-597	CLIP-seq
MIRT1213208	hsa-miR-628-3p	CLIP-seq
MIRT1213209	hsa-miR-642b	CLIP-seq
MIRT2289854	hsa-miR-1298	CLIP-seq
MIRT2289855	hsa-miR-1323	CLIP-seq
MIRT2061307	hsa-miR-1324	CLIP-seq
MIRT2289856	hsa-miR-198	CLIP-seq
MIRT1213186	hsa-miR-299-3p	CLIP-seq
MIRT2289857	hsa-miR-3941	CLIP-seq
MIRT1213195	hsa-miR-425	CLIP-seq
MIRT1213199	hsa-miR-4491	CLIP-seq
MIRT1213200	hsa-miR-4657	CLIP-seq
MIRT2289858	hsa-miR-466	CLIP-seq
MIRT2289859	hsa-miR-4672	CLIP-seq
MIRT2289860	hsa-miR-548o	CLIP-seq
MIRT1213209	hsa-miR-642b	CLIP-seq
MIRT1213186	hsa-miR-299-3p	CLIP-seq
MIRT1213199	hsa-miR-4491	CLIP-seq
MIRT1213200	hsa-miR-4657	CLIP-seq
MIRT2587803	hsa-miR-1207-3p	CLIP-seq
MIRT2587804	hsa-miR-122	CLIP-seq
MIRT2587805	hsa-miR-124	CLIP-seq
MIRT2587806	hsa-miR-1283	CLIP-seq
MIRT2587807	hsa-miR-1305	CLIP-seq
MIRT2289855	hsa-miR-1323	CLIP-seq
MIRT2061307	hsa-miR-1324	CLIP-seq
MIRT2587808	hsa-miR-134	CLIP-seq
MIRT2289856	hsa-miR-198	CLIP-seq
MIRT1213186	hsa-miR-299-3p	CLIP-seq
MIRT2587809	hsa-miR-3118	CLIP-seq
MIRT2061308	hsa-miR-3163	CLIP-seq
MIRT2587810	hsa-miR-3668	CLIP-seq
MIRT1213191	hsa-miR-369-3p	CLIP-seq
MIRT2587811	hsa-miR-3714	CLIP-seq
MIRT1213192	hsa-miR-374a	CLIP-seq
MIRT1213193	hsa-miR-374b	CLIP-seq
MIRT2587812	hsa-miR-3910	CLIP-seq
MIRT1213194	hsa-miR-3923	CLIP-seq
MIRT2289857	hsa-miR-3941	CLIP-seq
MIRT2587813	hsa-miR-3978	CLIP-seq
MIRT2587814	hsa-miR-410	CLIP-seq
MIRT1213196	hsa-miR-4281	CLIP-seq
MIRT2587815	hsa-miR-4282	CLIP-seq
MIRT2587816	hsa-miR-4476	CLIP-seq
MIRT2587817	hsa-miR-4477b	CLIP-seq
MIRT1213199	hsa-miR-4491	CLIP-seq
MIRT2587818	hsa-miR-4527	CLIP-seq
MIRT1213200	hsa-miR-4657	CLIP-seq
MIRT2289858	hsa-miR-466	CLIP-seq
MIRT2289859	hsa-miR-4672	CLIP-seq
MIRT2587819	hsa-miR-4760-5p	CLIP-seq
MIRT2587820	hsa-miR-506	CLIP-seq
MIRT2587821	hsa-miR-520d-5p	CLIP-seq
MIRT2587822	hsa-miR-522	CLIP-seq
MIRT2587823	hsa-miR-524-5p	CLIP-seq
MIRT2587824	hsa-miR-548a-3p	CLIP-seq
MIRT1213204	hsa-miR-548c-3p	CLIP-seq
MIRT2587825	hsa-miR-548e	CLIP-seq
MIRT2587826	hsa-miR-548f	CLIP-seq
MIRT2289860	hsa-miR-548o	CLIP-seq
MIRT1213205	hsa-miR-590-3p	CLIP-seq
MIRT1213206	hsa-miR-592	CLIP-seq
MIRT1213207	hsa-miR-597	CLIP-seq
MIRT1213208	hsa-miR-628-3p	CLIP-seq
MIRT1213209	hsa-miR-642b	CLIP-seq
MIRT2587827	hsa-miR-651	CLIP-seq
MIRT2587828	hsa-miR-875-3p	CLIP-seq
MIRT2587803	hsa-miR-1207-3p	CLIP-seq
MIRT2587804	hsa-miR-122	CLIP-seq
MIRT2587805	hsa-miR-124	CLIP-seq
MIRT2587807	hsa-miR-1305	CLIP-seq
MIRT2289855	hsa-miR-1323	CLIP-seq
MIRT2061307	hsa-miR-1324	CLIP-seq
MIRT2587808	hsa-miR-134	CLIP-seq
MIRT2289856	hsa-miR-198	CLIP-seq
MIRT1213186	hsa-miR-299-3p	CLIP-seq
MIRT2587809	hsa-miR-3118	CLIP-seq
MIRT2061308	hsa-miR-3163	CLIP-seq
MIRT2587810	hsa-miR-3668	CLIP-seq
MIRT1213191	hsa-miR-369-3p	CLIP-seq
MIRT2587811	hsa-miR-3714	CLIP-seq
MIRT1213192	hsa-miR-374a	CLIP-seq
MIRT1213193	hsa-miR-374b	CLIP-seq
MIRT2587812	hsa-miR-3910	CLIP-seq
MIRT1213194	hsa-miR-3923	CLIP-seq
MIRT2289857	hsa-miR-3941	CLIP-seq
MIRT2587813	hsa-miR-3978	CLIP-seq
MIRT1213196	hsa-miR-4281	CLIP-seq
MIRT2587815	hsa-miR-4282	CLIP-seq
MIRT2587816	hsa-miR-4476	CLIP-seq
MIRT2587817	hsa-miR-4477b	CLIP-seq
MIRT1213199	hsa-miR-4491	CLIP-seq
MIRT2587818	hsa-miR-4527	CLIP-seq
MIRT1213200	hsa-miR-4657	CLIP-seq
MIRT2289858	hsa-miR-466	CLIP-seq
MIRT2289859	hsa-miR-4672	CLIP-seq
MIRT2587819	hsa-miR-4760-5p	CLIP-seq
MIRT2587820	hsa-miR-506	CLIP-seq
MIRT2587822	hsa-miR-522	CLIP-seq
MIRT2587824	hsa-miR-548a-3p	CLIP-seq
MIRT1213204	hsa-miR-548c-3p	CLIP-seq
MIRT2587825	hsa-miR-548e	CLIP-seq
MIRT2587826	hsa-miR-548f	CLIP-seq
MIRT2289860	hsa-miR-548o	CLIP-seq
MIRT1213205	hsa-miR-590-3p	CLIP-seq
MIRT1213206	hsa-miR-592	CLIP-seq
MIRT1213207	hsa-miR-597	CLIP-seq
MIRT1213208	hsa-miR-628-3p	CLIP-seq
MIRT1213209	hsa-miR-642b	CLIP-seq
MIRT2587827	hsa-miR-651	CLIP-seq
MIRT2587828	hsa-miR-875-3p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000103	Process	Sulfate assimilation	IBA
GO:0000103	Process	Sulfate assimilation	IDA	14747722
GO:0000103	Process	Sulfate assimilation	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001501	Process	Skeletal system development	TAS	9771708
GO:0003824	Function	Catalytic activity	IEA
GO:0004020	Function	Adenylylsulfate kinase activity	IBA
GO:0004020	Function	Adenylylsulfate kinase activity	IDA	14747722, 23207770
GO:0004020	Function	Adenylylsulfate kinase activity	IEA
GO:0004020	Function	Adenylylsulfate kinase activity	TAS
GO:0004781	Function	Sulfate adenylyltransferase (ATP) activity	IDA	14747722
GO:0004781	Function	Sulfate adenylyltransferase (ATP) activity	IEA
GO:0004781	Function	Sulfate adenylyltransferase (ATP) activity	ISS
GO:0004781	Function	Sulfate adenylyltransferase (ATP) activity	TAS
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	22242175
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	22242175
GO:0005829	Component	Cytosol	TAS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	ISS
GO:0042803	Function	Protein homodimerization activity	IPI	14747722
GO:0050428	Process	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	IBA
GO:0050428	Process	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	IDA	14747722, 23207770
GO:0050428	Process	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	IEA
GO:0050428	Process	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	IEA
GO:0050428	Process	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	TAS

MIM	HGNC	e!Ensembl
603262	8603	ENSG00000138801

O43252

Protein name

Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 (PAPS synthase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK 1) (SK1) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (ATP-sulfurylase) (Sulfate adenylate transferase) (SAT); Adenylyl-sulfate kin

Protein function

Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the secon

PDB

1X6V , 1XJQ , 1XNJ , 2OFW , 2OFX , 2PEY , 2PEZ , 2QJF , 8I1M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01583	APS_kinase	51 → 209		Domain
PF14306	PUA_2	225 → 386	PUA-like domain	Domain
PF01747	ATP-sulfurylase	394 → 617	ATP-sulfurylase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis, pancreas, kidney, thymus, prostate, ovary, small intestine, colon, leukocytes and liver. Also expressed in high endothelial venules (HEV) cells and in cartilage. {ECO:0000269|PubMed:9576487}.

Sequence

MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
SGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
ADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
EIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVP
ENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGG
VINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTC
KNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGV
LNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPS
HGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQK
PPEGFMAPKAWTVLTEYYKSLEKA

Sequence length

624

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Selenocompound metabolism Sulfur metabolism Metabolic pathways Sulfur cycle		Transport and synthesis of PAPS Signaling by BRAF and RAF fusions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPSS1-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28790117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30146936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19337310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37684671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30283018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28790117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19337310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19337310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28790117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28790117, 31554135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24345920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28790117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26220590, 28790117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37684671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PAPSS1 (3'-phosphoadenosine 5'-phosphosulfate synthase 1)