Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9055
Gene name	Protein regulator of cytokinesis 1
Gene symbol	PRC1
Synonyms (NCBI Gene)	ASE1MAP65
Chromosome	15
Chromosome location	15q26.1
Summary	This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus d

335

Show/Hide all (335)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002532	hsa-miR-373-3p	Microarray	15685193
MIRT016238	hsa-miR-548b-3p	Sequencing	20371350
MIRT002532	hsa-miR-373-3p	Microarray;Other	15685193
MIRT049644	hsa-miR-92a-3p	CLASH	23622248
MIRT045708	hsa-miR-125a-5p	CLASH	23622248
MIRT040993	hsa-miR-505-3p	CLASH	23622248
MIRT052746	hsa-miR-1260b	CLASH	23622248
MIRT052746	hsa-miR-1260b	CLASH	23622248
MIRT574524	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT574523	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT574522	hsa-miR-5692a	PAR-CLIP	20371350
MIRT574521	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT574520	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT574519	hsa-miR-1324	PAR-CLIP	20371350
MIRT574518	hsa-miR-2277-3p	PAR-CLIP	20371350
MIRT574516	hsa-miR-3166	PAR-CLIP	20371350
MIRT574517	hsa-miR-633	PAR-CLIP	20371350
MIRT574515	hsa-miR-4473	PAR-CLIP	20371350
MIRT574514	hsa-miR-3977	PAR-CLIP	20371350
MIRT574524	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT574523	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT574522	hsa-miR-5692a	PAR-CLIP	20371350
MIRT574521	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT574520	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT574519	hsa-miR-1324	PAR-CLIP	20371350
MIRT574518	hsa-miR-2277-3p	PAR-CLIP	20371350
MIRT574516	hsa-miR-3166	PAR-CLIP	20371350
MIRT574517	hsa-miR-633	PAR-CLIP	20371350
MIRT574515	hsa-miR-4473	PAR-CLIP	20371350
MIRT574514	hsa-miR-3977	PAR-CLIP	20371350
MIRT1259679	hsa-miR-1205	CLIP-seq
MIRT1259680	hsa-miR-1207-3p	CLIP-seq
MIRT1259681	hsa-miR-1273d	CLIP-seq
MIRT1259682	hsa-miR-1278	CLIP-seq
MIRT1259683	hsa-miR-146a	CLIP-seq
MIRT1259684	hsa-miR-146b-5p	CLIP-seq
MIRT1259685	hsa-miR-150	CLIP-seq
MIRT1259686	hsa-miR-199a-3p	CLIP-seq
MIRT1259687	hsa-miR-199b-3p	CLIP-seq
MIRT1259688	hsa-miR-224	CLIP-seq
MIRT1259689	hsa-miR-3128	CLIP-seq
MIRT1259690	hsa-miR-3129-5p	CLIP-seq
MIRT1259691	hsa-miR-3136-5p	CLIP-seq
MIRT1259692	hsa-miR-3140-3p	CLIP-seq
MIRT1259693	hsa-miR-3185	CLIP-seq
MIRT1259694	hsa-miR-320e	CLIP-seq
MIRT1259695	hsa-miR-3591-3p	CLIP-seq
MIRT1259696	hsa-miR-3652	CLIP-seq
MIRT1259697	hsa-miR-3691-3p	CLIP-seq
MIRT1259698	hsa-miR-383	CLIP-seq
MIRT1259699	hsa-miR-4430	CLIP-seq
MIRT1259700	hsa-miR-4439	CLIP-seq
MIRT1259701	hsa-miR-4474-3p	CLIP-seq
MIRT1259702	hsa-miR-4490	CLIP-seq
MIRT1259703	hsa-miR-4505	CLIP-seq
MIRT1259704	hsa-miR-4513	CLIP-seq
MIRT1259705	hsa-miR-4514	CLIP-seq
MIRT1259706	hsa-miR-4645-3p	CLIP-seq
MIRT1259707	hsa-miR-4692	CLIP-seq
MIRT1259708	hsa-miR-4704-5p	CLIP-seq
MIRT1259709	hsa-miR-4772-5p	CLIP-seq
MIRT1259710	hsa-miR-4786-3p	CLIP-seq
MIRT1259711	hsa-miR-495	CLIP-seq
MIRT1259712	hsa-miR-498	CLIP-seq
MIRT1259713	hsa-miR-520f	CLIP-seq
MIRT1259714	hsa-miR-548ae	CLIP-seq
MIRT1259715	hsa-miR-548aj	CLIP-seq
MIRT1259716	hsa-miR-548am	CLIP-seq
MIRT1259717	hsa-miR-548x	CLIP-seq
MIRT1259718	hsa-miR-563	CLIP-seq
MIRT1259719	hsa-miR-580	CLIP-seq
MIRT1259720	hsa-miR-589	CLIP-seq
MIRT1259721	hsa-miR-660	CLIP-seq
MIRT1259722	hsa-miR-671-5p	CLIP-seq
MIRT1259723	hsa-miR-943	CLIP-seq
MIRT1259679	hsa-miR-1205	CLIP-seq
MIRT1259724	hsa-miR-1206	CLIP-seq
MIRT1259725	hsa-miR-1245	CLIP-seq
MIRT1259682	hsa-miR-1278	CLIP-seq
MIRT1259683	hsa-miR-146a	CLIP-seq
MIRT1259684	hsa-miR-146b-5p	CLIP-seq
MIRT1259686	hsa-miR-199a-3p	CLIP-seq
MIRT1259687	hsa-miR-199b-3p	CLIP-seq
MIRT1259726	hsa-miR-19a	CLIP-seq
MIRT1259727	hsa-miR-19b	CLIP-seq
MIRT1259728	hsa-miR-2355-5p	CLIP-seq
MIRT1259729	hsa-miR-3065-5p	CLIP-seq
MIRT1259690	hsa-miR-3129-5p	CLIP-seq
MIRT1259692	hsa-miR-3140-3p	CLIP-seq
MIRT1259730	hsa-miR-3180-5p	CLIP-seq
MIRT1259695	hsa-miR-3591-3p	CLIP-seq
MIRT1259697	hsa-miR-3691-3p	CLIP-seq
MIRT1259731	hsa-miR-3973	CLIP-seq
MIRT1259732	hsa-miR-4269	CLIP-seq
MIRT1259733	hsa-miR-4461	CLIP-seq
MIRT1259702	hsa-miR-4490	CLIP-seq
MIRT1259734	hsa-miR-4511	CLIP-seq
MIRT1259705	hsa-miR-4514	CLIP-seq
MIRT1259735	hsa-miR-4640-3p	CLIP-seq
MIRT1259706	hsa-miR-4645-3p	CLIP-seq
MIRT1259736	hsa-miR-4650-3p	CLIP-seq
MIRT1259707	hsa-miR-4692	CLIP-seq
MIRT1259708	hsa-miR-4704-5p	CLIP-seq
MIRT1259737	hsa-miR-4742-5p	CLIP-seq
MIRT1259738	hsa-miR-4781-3p	CLIP-seq
MIRT1259739	hsa-miR-485-3p	CLIP-seq
MIRT1259740	hsa-miR-510	CLIP-seq
MIRT1259741	hsa-miR-518a-5p	CLIP-seq
MIRT1259742	hsa-miR-520a-5p	CLIP-seq
MIRT1259713	hsa-miR-520f	CLIP-seq
MIRT1259743	hsa-miR-525-5p	CLIP-seq
MIRT1259744	hsa-miR-527	CLIP-seq
MIRT1259719	hsa-miR-580	CLIP-seq
MIRT1259720	hsa-miR-589	CLIP-seq
MIRT1259681	hsa-miR-1273d	CLIP-seq
MIRT1259745	hsa-miR-1275	CLIP-seq
MIRT1259746	hsa-miR-1323	CLIP-seq
MIRT1259747	hsa-miR-143	CLIP-seq
MIRT1259685	hsa-miR-150	CLIP-seq
MIRT1259748	hsa-miR-1915	CLIP-seq
MIRT1259686	hsa-miR-199a-3p	CLIP-seq
MIRT1259687	hsa-miR-199b-3p	CLIP-seq
MIRT1259726	hsa-miR-19a	CLIP-seq
MIRT1259727	hsa-miR-19b	CLIP-seq
MIRT1259749	hsa-miR-2053	CLIP-seq
MIRT1259688	hsa-miR-224	CLIP-seq
MIRT1259689	hsa-miR-3128	CLIP-seq
MIRT1259690	hsa-miR-3129-5p	CLIP-seq
MIRT1259750	hsa-miR-3132	CLIP-seq
MIRT1259751	hsa-miR-3175	CLIP-seq
MIRT1259730	hsa-miR-3180-5p	CLIP-seq
MIRT1259752	hsa-miR-361-3p	CLIP-seq
MIRT1259753	hsa-miR-3622a-5p	CLIP-seq
MIRT1259696	hsa-miR-3652	CLIP-seq
MIRT1259697	hsa-miR-3691-3p	CLIP-seq
MIRT1259754	hsa-miR-3923	CLIP-seq
MIRT1259755	hsa-miR-3945	CLIP-seq
MIRT1259731	hsa-miR-3973	CLIP-seq
MIRT1259756	hsa-miR-410	CLIP-seq
MIRT1259757	hsa-miR-4253	CLIP-seq
MIRT1259732	hsa-miR-4269	CLIP-seq
MIRT1259758	hsa-miR-4423-3p	CLIP-seq
MIRT1259699	hsa-miR-4430	CLIP-seq
MIRT1259701	hsa-miR-4474-3p	CLIP-seq
MIRT1259703	hsa-miR-4505	CLIP-seq
MIRT1259734	hsa-miR-4511	CLIP-seq
MIRT1259705	hsa-miR-4514	CLIP-seq
MIRT1259759	hsa-miR-4525	CLIP-seq
MIRT1259735	hsa-miR-4640-3p	CLIP-seq
MIRT1259736	hsa-miR-4650-3p	CLIP-seq
MIRT1259760	hsa-miR-4665-5p	CLIP-seq
MIRT1259707	hsa-miR-4692	CLIP-seq
MIRT1259761	hsa-miR-4706	CLIP-seq
MIRT1259762	hsa-miR-4712-3p	CLIP-seq
MIRT1259763	hsa-miR-4723-5p	CLIP-seq
MIRT1259764	hsa-miR-4734	CLIP-seq
MIRT1259737	hsa-miR-4742-5p	CLIP-seq
MIRT1259765	hsa-miR-4749-5p	CLIP-seq
MIRT1259766	hsa-miR-4770	CLIP-seq
MIRT1259767	hsa-miR-4787-5p	CLIP-seq
MIRT1259711	hsa-miR-495	CLIP-seq
MIRT1259768	hsa-miR-5095	CLIP-seq
MIRT1259740	hsa-miR-510	CLIP-seq
MIRT1259741	hsa-miR-518a-5p	CLIP-seq
MIRT1259742	hsa-miR-520a-5p	CLIP-seq
MIRT1259713	hsa-miR-520f	CLIP-seq
MIRT1259743	hsa-miR-525-5p	CLIP-seq
MIRT1259744	hsa-miR-527	CLIP-seq
MIRT1259769	hsa-miR-548aa	CLIP-seq
MIRT1259770	hsa-miR-548o	CLIP-seq
MIRT1259771	hsa-miR-552	CLIP-seq
MIRT1259772	hsa-miR-569	CLIP-seq
MIRT1259773	hsa-miR-625	CLIP-seq
MIRT1259721	hsa-miR-660	CLIP-seq
MIRT1259774	hsa-miR-744	CLIP-seq
MIRT2076508	hsa-miR-1183	CLIP-seq
MIRT2076509	hsa-miR-1185	CLIP-seq
MIRT1259679	hsa-miR-1205	CLIP-seq
MIRT1259680	hsa-miR-1207-3p	CLIP-seq
MIRT1259725	hsa-miR-1245	CLIP-seq
MIRT2076510	hsa-miR-1271	CLIP-seq
MIRT1259745	hsa-miR-1275	CLIP-seq
MIRT1259682	hsa-miR-1278	CLIP-seq
MIRT1259747	hsa-miR-143	CLIP-seq
MIRT2076511	hsa-miR-182	CLIP-seq
MIRT2076512	hsa-miR-1972	CLIP-seq
MIRT1259686	hsa-miR-199a-3p	CLIP-seq
MIRT1259687	hsa-miR-199b-3p	CLIP-seq
MIRT1259726	hsa-miR-19a	CLIP-seq
MIRT1259727	hsa-miR-19b	CLIP-seq
MIRT1259688	hsa-miR-224	CLIP-seq
MIRT1259728	hsa-miR-2355-5p	CLIP-seq
MIRT2076513	hsa-miR-299-3p	CLIP-seq
MIRT2076514	hsa-miR-30a	CLIP-seq
MIRT2076515	hsa-miR-30b	CLIP-seq
MIRT2076516	hsa-miR-30c	CLIP-seq
MIRT2076517	hsa-miR-30d	CLIP-seq
MIRT2076518	hsa-miR-30e	CLIP-seq
MIRT2076519	hsa-miR-3123	CLIP-seq
MIRT1259689	hsa-miR-3128	CLIP-seq
MIRT1259690	hsa-miR-3129-5p	CLIP-seq
MIRT1259750	hsa-miR-3132	CLIP-seq
MIRT1259691	hsa-miR-3136-5p	CLIP-seq
MIRT1259751	hsa-miR-3175	CLIP-seq
MIRT1259730	hsa-miR-3180-5p	CLIP-seq
MIRT2076520	hsa-miR-320a	CLIP-seq
MIRT2076521	hsa-miR-320b	CLIP-seq
MIRT2076522	hsa-miR-320c	CLIP-seq
MIRT2076523	hsa-miR-320d	CLIP-seq
MIRT2076524	hsa-miR-34a	CLIP-seq
MIRT2076525	hsa-miR-34c-5p	CLIP-seq
MIRT2076526	hsa-miR-3529	CLIP-seq
MIRT1259695	hsa-miR-3591-3p	CLIP-seq
MIRT2076527	hsa-miR-3614-3p	CLIP-seq
MIRT2076528	hsa-miR-3617	CLIP-seq
MIRT1259753	hsa-miR-3622a-5p	CLIP-seq
MIRT1259696	hsa-miR-3652	CLIP-seq
MIRT2076529	hsa-miR-3667-3p	CLIP-seq
MIRT2076530	hsa-miR-3679-5p	CLIP-seq
MIRT1259697	hsa-miR-3691-3p	CLIP-seq
MIRT2076531	hsa-miR-379	CLIP-seq
MIRT2076532	hsa-miR-3925-5p	CLIP-seq
MIRT1259731	hsa-miR-3973	CLIP-seq
MIRT1259756	hsa-miR-410	CLIP-seq
MIRT1259732	hsa-miR-4269	CLIP-seq
MIRT2076533	hsa-miR-4282	CLIP-seq
MIRT2076534	hsa-miR-4297	CLIP-seq
MIRT2076535	hsa-miR-4325	CLIP-seq
MIRT2076536	hsa-miR-4421	CLIP-seq
MIRT1259758	hsa-miR-4423-3p	CLIP-seq
MIRT2076537	hsa-miR-4429	CLIP-seq
MIRT1259699	hsa-miR-4430	CLIP-seq
MIRT2076538	hsa-miR-4436b-3p	CLIP-seq
MIRT1259700	hsa-miR-4439	CLIP-seq
MIRT2076539	hsa-miR-4451	CLIP-seq
MIRT1259733	hsa-miR-4461	CLIP-seq
MIRT2076540	hsa-miR-4475	CLIP-seq
MIRT2076541	hsa-miR-4491	CLIP-seq
MIRT2076542	hsa-miR-449a	CLIP-seq
MIRT2076543	hsa-miR-449b	CLIP-seq
MIRT1259703	hsa-miR-4505	CLIP-seq
MIRT1259734	hsa-miR-4511	CLIP-seq
MIRT1259704	hsa-miR-4513	CLIP-seq
MIRT1259705	hsa-miR-4514	CLIP-seq
MIRT1259759	hsa-miR-4525	CLIP-seq
MIRT2076544	hsa-miR-4529-5p	CLIP-seq
MIRT2076545	hsa-miR-4536	CLIP-seq
MIRT1259706	hsa-miR-4645-3p	CLIP-seq
MIRT1259736	hsa-miR-4650-3p	CLIP-seq
MIRT2076546	hsa-miR-4650-5p	CLIP-seq
MIRT2076547	hsa-miR-4657	CLIP-seq
MIRT2076548	hsa-miR-4659a-5p	CLIP-seq
MIRT2076549	hsa-miR-4659b-5p	CLIP-seq
MIRT1259760	hsa-miR-4665-5p	CLIP-seq
MIRT1259707	hsa-miR-4692	CLIP-seq
MIRT1259761	hsa-miR-4706	CLIP-seq
MIRT1259762	hsa-miR-4712-3p	CLIP-seq
MIRT1259763	hsa-miR-4723-5p	CLIP-seq
MIRT1259764	hsa-miR-4734	CLIP-seq
MIRT1259737	hsa-miR-4742-5p	CLIP-seq
MIRT1259765	hsa-miR-4749-5p	CLIP-seq
MIRT2076550	hsa-miR-4761-3p	CLIP-seq
MIRT1259766	hsa-miR-4770	CLIP-seq
MIRT2076551	hsa-miR-4776-3p	CLIP-seq
MIRT1259738	hsa-miR-4781-3p	CLIP-seq
MIRT1259710	hsa-miR-4786-3p	CLIP-seq
MIRT1259767	hsa-miR-4787-5p	CLIP-seq
MIRT1259711	hsa-miR-495	CLIP-seq
MIRT2076552	hsa-miR-507	CLIP-seq
MIRT1259740	hsa-miR-510	CLIP-seq
MIRT1259741	hsa-miR-518a-5p	CLIP-seq
MIRT1259742	hsa-miR-520a-5p	CLIP-seq
MIRT1259713	hsa-miR-520f	CLIP-seq
MIRT1259743	hsa-miR-525-5p	CLIP-seq
MIRT1259744	hsa-miR-527	CLIP-seq
MIRT1259714	hsa-miR-548ae	CLIP-seq
MIRT1259715	hsa-miR-548aj	CLIP-seq
MIRT1259716	hsa-miR-548am	CLIP-seq
MIRT1259717	hsa-miR-548x	CLIP-seq
MIRT2076553	hsa-miR-557	CLIP-seq
MIRT1259718	hsa-miR-563	CLIP-seq
MIRT1259773	hsa-miR-625	CLIP-seq
MIRT2076554	hsa-miR-641	CLIP-seq
MIRT2076555	hsa-miR-645	CLIP-seq
MIRT1259722	hsa-miR-671-5p	CLIP-seq
MIRT1259774	hsa-miR-744	CLIP-seq
MIRT2076556	hsa-miR-9	CLIP-seq
MIRT1259723	hsa-miR-943	CLIP-seq
MIRT2076557	hsa-miR-96	CLIP-seq
MIRT2076509	hsa-miR-1185	CLIP-seq
MIRT1259681	hsa-miR-1273d	CLIP-seq
MIRT2303147	hsa-miR-1276	CLIP-seq
MIRT1259685	hsa-miR-150	CLIP-seq
MIRT2076513	hsa-miR-299-3p	CLIP-seq
MIRT2303148	hsa-miR-3146	CLIP-seq
MIRT2303149	hsa-miR-3189-5p	CLIP-seq
MIRT1259696	hsa-miR-3652	CLIP-seq
MIRT2076530	hsa-miR-3679-5p	CLIP-seq
MIRT2076533	hsa-miR-4282	CLIP-seq
MIRT2303150	hsa-miR-4291	CLIP-seq
MIRT2303151	hsa-miR-4311	CLIP-seq
MIRT2076535	hsa-miR-4325	CLIP-seq
MIRT1259699	hsa-miR-4430	CLIP-seq
MIRT1259701	hsa-miR-4474-3p	CLIP-seq
MIRT2076540	hsa-miR-4475	CLIP-seq
MIRT2076541	hsa-miR-4491	CLIP-seq
MIRT1259703	hsa-miR-4505	CLIP-seq
MIRT2076547	hsa-miR-4657	CLIP-seq
MIRT2076548	hsa-miR-4659a-5p	CLIP-seq
MIRT2076549	hsa-miR-4659b-5p	CLIP-seq
MIRT2076551	hsa-miR-4776-3p	CLIP-seq
MIRT1259738	hsa-miR-4781-3p	CLIP-seq
MIRT2076552	hsa-miR-507	CLIP-seq
MIRT2303152	hsa-miR-545	CLIP-seq
MIRT2076553	hsa-miR-557	CLIP-seq
MIRT2303153	hsa-miR-583	CLIP-seq
MIRT1259721	hsa-miR-660	CLIP-seq
MIRT2392940	hsa-miR-147	CLIP-seq
MIRT2392941	hsa-miR-1914	CLIP-seq
MIRT2392942	hsa-miR-194	CLIP-seq
MIRT2392943	hsa-miR-3144-5p	CLIP-seq
MIRT2392944	hsa-miR-3191	CLIP-seq
MIRT2392945	hsa-miR-3911	CLIP-seq
MIRT2392946	hsa-miR-4652-5p	CLIP-seq
MIRT2392947	hsa-miR-491-5p	CLIP-seq
MIRT1259741	hsa-miR-518a-5p	CLIP-seq
MIRT1259744	hsa-miR-527	CLIP-seq
MIRT2392948	hsa-miR-541	CLIP-seq
MIRT2392949	hsa-miR-644	CLIP-seq
MIRT2392950	hsa-miR-654-5p	CLIP-seq
MIRT1259722	hsa-miR-671-5p	CLIP-seq
MIRT2465897	hsa-miR-139-5p	CLIP-seq
MIRT2465898	hsa-miR-3685	CLIP-seq
MIRT2465899	hsa-miR-384	CLIP-seq
MIRT2465900	hsa-miR-4705	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TP53	Repression	12889596

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000022	Process	Mitotic spindle elongation	TAS	9885575
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	14744859, 16189514, 16431929, 17409436, 19447967, 19468300, 23036704, 28514442, 32296183, 33961781, 35849559
GO:0005634	Component	Nucleus	IDA	17409436
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9885575
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IBA
GO:0005819	Component	Spindle	IDA	17351640
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	TAS	9885575
GO:0005886	Component	Plasma membrane	IDA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	17409436
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0019894	Function	Kinesin binding	IPI	16431929
GO:0019901	Function	Protein kinase binding	IPI	17351640
GO:0030496	Component	Midbody	IDA	17409436, 35849559
GO:0030496	Component	Midbody	IEA
GO:0032465	Process	Regulation of cytokinesis	IDA	17351640
GO:0042802	Function	Identical protein binding	IPI	16603632, 20691902, 23870126
GO:0045171	Component	Intercellular bridge	IDA
GO:0051256	Process	Mitotic spindle midzone assembly	IBA
GO:0051301	Process	Cell division	IEA
GO:0070938	Component	Contractile ring	IDA	17409436
GO:1990023	Component	Mitotic spindle midzone	IBA

MIM	HGNC	e!Ensembl
603484	9341	ENSG00000198901

O43663

Protein name

Protein regulator of cytokinesis 1

Protein function

Key regulator of cytokinesis that cross-links antiparrallel microtubules at an average distance of 35 nM. Essential for controlling the spatiotemporal formation of the midzone and successful cytokinesis. Required for KIF14 localization to the ce

PDB

3NRX , 3NRY , 4L3I , 4L6Y , 5KMG , 7VBG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03999	MAP65_ASE1	35 → 615		Family

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in bladder cancer cells (PubMed:17409436). {ECO:0000269|PubMed:17409436}.

Sequence

MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEES
LKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQE
LKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQ
IILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLR
TQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVE
LVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEE
TWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPN
TPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTG
RHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQREL
SKASKSDATSGILNSTNIQS

Sequence length

620

Interactions

View interactions

	Reactome
			RHO GTPases activate CIT

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast carcinoma	association	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (89)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22085718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28646916, 30881920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16817948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26941395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	36524512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33407587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	14742259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	26623561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	32157296	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17233835, 18289367, 18587273, 25038754, 27053251, 27505863, 30139998		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25038754		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	25038754, 29059683		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Breast Carcinoma	Breast Carcinoma	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Breast Neoplasms	Breast neoplasm	Pubtator	18289367, 18587273, 23648477, 25038754, 27053251, 28061449, 34384030, 37713876	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	28190297, 31922238, 33706578, 36524512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30702595, 31043166, 31746405, 31811111, 31822116, 32685988, 33946043, 34737790, 34746301, 36553600, 36566204, 36882493, 39596041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35983074	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	14965441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16690207, 18289367, 29435157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	40093809	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35872842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	15936590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31545466, 33706578	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	19723660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16817948, 18289367, 30429953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34120619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	33318199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25273842, 26290879, 27053251, 37738238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	20581827, 28869590, 30054458, 30718926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	20581827, 21647700, 22885922, 23300278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22046406, 27053251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37563591	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32685988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27291091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30720120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28087428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30709419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36524512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24652950		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	17374722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35015684, 35650206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	19451220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24953053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	29752448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	21693658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26941395, 28382142, 29748662, 30145863, 30948333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18289367, 31789390, 36135961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11199923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29752448, 33706578	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28412742, 30814291		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	17233835, 18289367, 18587273, 25038754, 27053251, 30139998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25038754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29097204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16690207, 18289367, 29435157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	31043753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26898432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28190297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17409436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16529553, 18587273, 19602592, 26898432, 27893710, 28329686, 29187402, 29337063, 29379165, 29413422, 29886801, 30068546, 30380541, 30429953, 30655550, 30992425, 31408617 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19723660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25038754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17233835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25038754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25038754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	31408617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29262596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	38451221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29383137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37647439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17374722, 27505863, 27864346, 28190297, 28577303, 28646916, 29050200, 29229426, 29379165, 29413422, 29748662, 29752448, 30643969, 30655550, 31408617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29435157, 31323431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33176597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	31043753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23542236, 31043753	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31922238	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	26898432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21840484, 35513262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	31144388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	32747783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	35194152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29752448, 32228488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28840006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28190297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28190297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28412742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31792072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23405241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRC1 (protein regulator of cytokinesis 1)