Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	90522
Gene name	Yip1 interacting factor homolog B, membrane trafficking protein
Gene symbol	YIF1B
Synonyms (NCBI Gene)	FinGER8KABAMAS
Chromosome	19
Chromosome location	19q13.2

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001396	hsa-miR-16-5p	pSILAC	18668040
MIRT027066	hsa-miR-103a-3p	Sequencing	20371350
MIRT001396	hsa-miR-16-5p	Sequencing	20371350
MIRT001396	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT049802	hsa-miR-92a-3p	CLASH	23622248
MIRT1498662	hsa-miR-103a	CLIP-seq
MIRT1498663	hsa-miR-107	CLIP-seq
MIRT1498664	hsa-miR-149	CLIP-seq
MIRT1498665	hsa-miR-214	CLIP-seq
MIRT1498666	hsa-miR-331-3p	CLIP-seq
MIRT1498667	hsa-miR-3619-5p	CLIP-seq
MIRT1498668	hsa-miR-3691-3p	CLIP-seq
MIRT1498669	hsa-miR-4690-5p	CLIP-seq
MIRT1498670	hsa-miR-4749-3p	CLIP-seq
MIRT1498671	hsa-miR-503	CLIP-seq
MIRT1498672	hsa-miR-761	CLIP-seq
MIRT1498673	hsa-miR-885-3p	CLIP-seq
MIRT1498662	hsa-miR-103a	CLIP-seq
MIRT1498663	hsa-miR-107	CLIP-seq
MIRT1498674	hsa-miR-1179	CLIP-seq
MIRT1498675	hsa-miR-1207-3p	CLIP-seq
MIRT1498676	hsa-miR-1293	CLIP-seq
MIRT1498677	hsa-miR-130a	CLIP-seq
MIRT1498678	hsa-miR-130b	CLIP-seq
MIRT1498679	hsa-miR-15a	CLIP-seq
MIRT1498680	hsa-miR-15b	CLIP-seq
MIRT1498681	hsa-miR-16	CLIP-seq
MIRT1498682	hsa-miR-195	CLIP-seq
MIRT1498683	hsa-miR-301a	CLIP-seq
MIRT1498684	hsa-miR-301b	CLIP-seq
MIRT1498685	hsa-miR-3151	CLIP-seq
MIRT1498686	hsa-miR-3180	CLIP-seq
MIRT1498687	hsa-miR-3180-3p	CLIP-seq
MIRT1498688	hsa-miR-3196	CLIP-seq
MIRT1498689	hsa-miR-361-3p	CLIP-seq
MIRT1498690	hsa-miR-3666	CLIP-seq
MIRT1498691	hsa-miR-3944-5p	CLIP-seq
MIRT1498692	hsa-miR-424	CLIP-seq
MIRT1498693	hsa-miR-4295	CLIP-seq
MIRT1498694	hsa-miR-4310	CLIP-seq
MIRT1498695	hsa-miR-4483	CLIP-seq
MIRT1498696	hsa-miR-4530	CLIP-seq
MIRT1498697	hsa-miR-454	CLIP-seq
MIRT1498698	hsa-miR-4639-5p	CLIP-seq
MIRT1498699	hsa-miR-4642	CLIP-seq
MIRT1498700	hsa-miR-4671-3p	CLIP-seq
MIRT1498701	hsa-miR-4691-5p	CLIP-seq
MIRT1498702	hsa-miR-4720-5p	CLIP-seq
MIRT1498703	hsa-miR-4799-3p	CLIP-seq
MIRT1498704	hsa-miR-497	CLIP-seq
MIRT1498671	hsa-miR-503	CLIP-seq
MIRT1498705	hsa-miR-642b	CLIP-seq
MIRT1498691	hsa-miR-3944-5p	CLIP-seq
MIRT2397128	hsa-miR-1205	CLIP-seq
MIRT2397129	hsa-miR-143	CLIP-seq
MIRT2397130	hsa-miR-2861	CLIP-seq
MIRT2397131	hsa-miR-3189-3p	CLIP-seq
MIRT2397132	hsa-miR-4260	CLIP-seq
MIRT2397133	hsa-miR-4514	CLIP-seq
MIRT2397134	hsa-miR-4692	CLIP-seq
MIRT2397135	hsa-miR-4722-5p	CLIP-seq
MIRT2397136	hsa-miR-4742-3p	CLIP-seq
MIRT2397137	hsa-miR-4768-3p	CLIP-seq
MIRT2397138	hsa-miR-4770	CLIP-seq
MIRT2397139	hsa-miR-940	CLIP-seq
MIRT1498679	hsa-miR-15a	CLIP-seq
MIRT1498680	hsa-miR-15b	CLIP-seq
MIRT1498681	hsa-miR-16	CLIP-seq
MIRT1498682	hsa-miR-195	CLIP-seq
MIRT1498692	hsa-miR-424	CLIP-seq
MIRT1498704	hsa-miR-497	CLIP-seq
MIRT1498671	hsa-miR-503	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	28298427, 30877195, 32296183, 33961781
GO:0005783	Component	Endoplasmic reticulum	IDA	26077767
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IBA
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	26077767
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IEA
GO:0005794	Component	Golgi apparatus	IDA	26077767
GO:0005794	Component	Golgi apparatus	IEA
GO:0006612	Process	Protein targeting to membrane	IEA
GO:0006612	Process	Protein targeting to membrane	ISS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	33103737
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030134	Component	COPII-coated ER to Golgi transport vesicle	IBA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:0120316	Process	Sperm flagellum assembly	IEA

MIM	HGNC	e!Ensembl
619109	30511	ENSG00000167645

Q5BJH7

Protein name

Protein YIF1B (YIP1-interacting factor homolog B)

Protein function

Functions in endoplasmic reticulum to Golgi vesicle-mediated transport and regulates the proper organization of the endoplasmic reticulum and the Golgi (By similarity). Plays a key role in targeting to neuronal dendrites receptors such as HTR1A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03878	YIF1	74 → 309	YIF1	Family

Sequence

MHPAGLAAAAAGTPRLRKWPSKRRIPVSQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLS
YPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYV
GRKLGLLFFPYLHQDWEVQYQQDTPVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDR
FSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMG
LLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAAAEGVPVRGARNQLRMYLTMAVAAA
QPMLMYWLTFHLVR

Sequence length

314

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Kaya-Barakat-Masson syndrome	Pathogenic	rs1969221767, rs1969205933, rs750308729, rs564705275, rs1969205627, rs1969106432	RCV001270687 RCV001270684 RCV001270685 RCV001270686 RCV001270688 RCV001270689 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER-SPASTICITY-MOVEMENT DISORDER-EPILEPTIC SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	32648580	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32648580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	32648580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

YIF1B (Yip1 interacting factor homolog B, membrane trafficking protein)