DOK2 (docking protein 2)

Gene

• Entrez ID: 9046
• Gene name: Docking protein 2
• Gene symbol: DOK2
• Synonyms (NCBI Gene): p56DOK, p56dok-2
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein wh

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041270	hsa-miR-193b-3p	CLASH	23622248
MIRT498423	hsa-miR-365a-3p	PAR-CLIP	22291592
MIRT498422	hsa-miR-365b-3p	PAR-CLIP	22291592
MIRT498421	hsa-miR-155-5p	PAR-CLIP	22291592
MIRT498420	hsa-miR-4715-3p	PAR-CLIP	22291592
MIRT498423	hsa-miR-365a-3p	PAR-CLIP	22291592
MIRT498422	hsa-miR-365b-3p	PAR-CLIP	22291592
MIRT498421	hsa-miR-155-5p	PAR-CLIP	22291592
MIRT498420	hsa-miR-4715-3p	PAR-CLIP	22291592
MIRT2214388	hsa-miR-103b	CLIP-seq
MIRT2214389	hsa-miR-1226	CLIP-seq
MIRT2214390	hsa-miR-153	CLIP-seq
MIRT2214391	hsa-miR-298	CLIP-seq
MIRT2214392	hsa-miR-4459	CLIP-seq
MIRT2214393	hsa-miR-448	CLIP-seq
MIRT2214394	hsa-miR-4530	CLIP-seq
MIRT2214395	hsa-miR-4662a-5p	CLIP-seq
MIRT2214396	hsa-miR-4690-3p	CLIP-seq
MIRT2214397	hsa-miR-4733-3p	CLIP-seq
MIRT2214398	hsa-miR-4786-3p	CLIP-seq
MIRT2214399	hsa-miR-634	CLIP-seq
MIRT2214400	hsa-miR-765	CLIP-seq
MIRT2214401	hsa-miR-922	CLIP-seq
MIRT2387071	hsa-miR-4779	CLIP-seq
MIRT2214388	hsa-miR-103b	CLIP-seq
MIRT2214390	hsa-miR-153	CLIP-seq
MIRT2214393	hsa-miR-448	CLIP-seq
MIRT2214395	hsa-miR-4662a-5p	CLIP-seq
MIRT2214396	hsa-miR-4690-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IEA
GO:0005515	Function	Protein binding	IPI	21044950, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0007165	Process	Signal transduction	TAS	9478921, 10799545
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10799545
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IEA

Other IDs

• MIM: 604997
• HGNC: 2991
• e!Ensembl: ENSG00000147443

Protein

• UniProt ID: O60496
• Protein name: Docking protein 2 (Downstream of tyrosine kinase 2) (p56(dok-2))
• Protein function: DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK2 may modulate the cellular proliferation induced by IL-4, as well as IL-2 and IL-3.
• PDB: 2D9W, 2DLW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02174	IRS	147 → 247	PTB domain (IRS-1 type)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes, lymph nodes and spleen. Lower expression in thymus, bone marrow and fetal liver. {ECO:0000269|PubMed:9478921}.
• Sequence:

  MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI
  RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKE
  LSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALE
  LWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEE
  AISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA
  VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSP
  QEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK

• Sequence length: 412

Pathways

Reactome:

Tie2 Signaling
RET signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	29098030		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22130622, 24255704, 27975172, 30475228		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30206226		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27975172		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29098030		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26070530	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20139980		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30206226	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23684582		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24243566	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37884639	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	22130622		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	25118816		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	25118816		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16823827		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16823827, 20697350	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29150948		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20139980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	20139980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	29098030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20139980		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	20139980		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23684582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22130622, 27975172		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22130622		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22130622, 24255704, 25118816, 29098030		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29548825		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40668798	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23684582		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23684582, 29229600	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30206226	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25118816		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	30652956		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22130622, 27975172		★☆☆☆☆ Found in Text Mining only