BMF (Bcl2 modifying factor)

Gene

• Entrez ID: 90427
• Gene name: Bcl2 modifying factor
• Gene symbol: BMF
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003394	hsa-miR-125b-5p	immunoblot, Luciferase reporter assay, qRT-PCR	19471102
MIRT003394	hsa-miR-125b-5p	Review	20029422
MIRT000141	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	19671867
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT438409	hsa-miR-197-3p	Flow, Luciferase reporter assay, qRT-PCR	24488097
MIRT822230	hsa-miR-1343	CLIP-seq
MIRT822231	hsa-miR-153	CLIP-seq
MIRT822232	hsa-miR-3119	CLIP-seq
MIRT822233	hsa-miR-4426	CLIP-seq
MIRT822234	hsa-miR-448	CLIP-seq
MIRT822235	hsa-miR-4534	CLIP-seq
MIRT822236	hsa-miR-4647	CLIP-seq
MIRT822237	hsa-miR-4662b	CLIP-seq
MIRT822238	hsa-miR-2467-3p	CLIP-seq
MIRT822239	hsa-miR-298	CLIP-seq
MIRT822240	hsa-miR-3064-3p	CLIP-seq
MIRT822241	hsa-miR-3158-5p	CLIP-seq
MIRT822242	hsa-miR-3678-3p	CLIP-seq
MIRT822243	hsa-miR-4493	CLIP-seq
MIRT822244	hsa-miR-4760-5p	CLIP-seq
MIRT1922597	hsa-miR-1200	CLIP-seq
MIRT1922598	hsa-miR-1976	CLIP-seq
MIRT1922599	hsa-miR-2467-5p	CLIP-seq
MIRT1922600	hsa-miR-3184	CLIP-seq
MIRT1922601	hsa-miR-3188	CLIP-seq
MIRT1922602	hsa-miR-3975	CLIP-seq
MIRT1922603	hsa-miR-423-5p	CLIP-seq
MIRT1922604	hsa-miR-4324	CLIP-seq
MIRT1922605	hsa-miR-4649-3p	CLIP-seq
MIRT1922606	hsa-miR-4688	CLIP-seq
MIRT1922607	hsa-miR-4723-5p	CLIP-seq
MIRT1922608	hsa-miR-4728-5p	CLIP-seq
MIRT1922609	hsa-miR-4736	CLIP-seq
MIRT1922610	hsa-miR-485-5p	CLIP-seq
MIRT1922611	hsa-miR-486-3p	CLIP-seq
MIRT1922612	hsa-miR-544b	CLIP-seq
MIRT1942999	hsa-miR-1207-3p	CLIP-seq
MIRT2181765	hsa-miR-1208	CLIP-seq
MIRT2181766	hsa-miR-1285	CLIP-seq
MIRT822230	hsa-miR-1343	CLIP-seq
MIRT2181767	hsa-miR-1915	CLIP-seq
MIRT2181768	hsa-miR-24	CLIP-seq
MIRT2181769	hsa-miR-29a	CLIP-seq
MIRT2181770	hsa-miR-29b	CLIP-seq
MIRT2181771	hsa-miR-29c	CLIP-seq
MIRT2181772	hsa-miR-3187-5p	CLIP-seq
MIRT2181773	hsa-miR-3189-5p	CLIP-seq
MIRT2181774	hsa-miR-3607-5p	CLIP-seq
MIRT2181775	hsa-miR-3611	CLIP-seq
MIRT2181776	hsa-miR-3616-3p	CLIP-seq
MIRT2181777	hsa-miR-3649	CLIP-seq
MIRT2181778	hsa-miR-3664-3p	CLIP-seq
MIRT2181779	hsa-miR-3667-3p	CLIP-seq
MIRT2181780	hsa-miR-3682-5p	CLIP-seq
MIRT2181781	hsa-miR-3691-3p	CLIP-seq
MIRT2181782	hsa-miR-409-3p	CLIP-seq
MIRT2181783	hsa-miR-4277	CLIP-seq
MIRT2181784	hsa-miR-4420	CLIP-seq
MIRT2181785	hsa-miR-4436b-3p	CLIP-seq
MIRT2181786	hsa-miR-4468	CLIP-seq
MIRT2181787	hsa-miR-4648	CLIP-seq
MIRT2181788	hsa-miR-4674	CLIP-seq
MIRT2181789	hsa-miR-4690-3p	CLIP-seq
MIRT2181790	hsa-miR-4709-3p	CLIP-seq
MIRT2181791	hsa-miR-4726-3p	CLIP-seq
MIRT2181792	hsa-miR-4758-3p	CLIP-seq
MIRT2181793	hsa-miR-4778-3p	CLIP-seq
MIRT2181794	hsa-miR-511	CLIP-seq
MIRT2181795	hsa-miR-520a-5p	CLIP-seq
MIRT2181796	hsa-miR-525-5p	CLIP-seq
MIRT2181797	hsa-miR-612	CLIP-seq
MIRT2181798	hsa-miR-760	CLIP-seq
MIRT822230	hsa-miR-1343	CLIP-seq
MIRT2181778	hsa-miR-3664-3p	CLIP-seq
MIRT2384791	hsa-miR-4685-5p	CLIP-seq
MIRT2435797	hsa-miR-1229	CLIP-seq
MIRT2441994	hsa-miR-1202	CLIP-seq
MIRT1942999	hsa-miR-1207-3p	CLIP-seq
MIRT2441995	hsa-miR-124	CLIP-seq
MIRT2441996	hsa-miR-15a	CLIP-seq
MIRT2441997	hsa-miR-15b	CLIP-seq
MIRT2441998	hsa-miR-16	CLIP-seq
MIRT2181767	hsa-miR-1915	CLIP-seq
MIRT2441999	hsa-miR-195	CLIP-seq
MIRT2442000	hsa-miR-205	CLIP-seq
MIRT2442001	hsa-miR-3194-5p	CLIP-seq
MIRT2442002	hsa-miR-3972	CLIP-seq
MIRT2442003	hsa-miR-421	CLIP-seq
MIRT2442004	hsa-miR-424	CLIP-seq
MIRT2442005	hsa-miR-4281	CLIP-seq
MIRT2442006	hsa-miR-4438	CLIP-seq
MIRT2442007	hsa-miR-4530	CLIP-seq
MIRT2442008	hsa-miR-4709-5p	CLIP-seq
MIRT2181791	hsa-miR-4726-3p	CLIP-seq
MIRT2442009	hsa-miR-497	CLIP-seq
MIRT2442010	hsa-miR-506	CLIP-seq
MIRT2442011	hsa-miR-548an	CLIP-seq
MIRT2442012	hsa-miR-642b	CLIP-seq
MIRT2181795	hsa-miR-520a-5p	CLIP-seq
MIRT2181796	hsa-miR-525-5p	CLIP-seq
MIRT2675997	hsa-miR-3657	CLIP-seq
MIRT2675998	hsa-miR-4302	CLIP-seq
MIRT2675999	hsa-miR-4669	CLIP-seq
MIRT2676000	hsa-miR-4676-5p	CLIP-seq
MIRT2676001	hsa-miR-4697-3p	CLIP-seq
MIRT2676002	hsa-miR-575	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11546872, 25416956, 26871637, 31515488, 32296183, 32814053
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0010507	Process	Negative regulation of autophagy	IBA
GO:0010507	Process	Negative regulation of autophagy	IDA	23629966
GO:0016459	Component	Myosin complex	IBA
GO:0016459	Component	Myosin complex	ISS	11546872
GO:0031334	Process	Positive regulation of protein-containing complex assembly	ISS
GO:0034644	Process	Cellular response to UV	IDA	23629966
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	19671867
GO:0043276	Process	Anoikis	IDA	11546872
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	ISS

Other IDs

• MIM: 606266
• HGNC: 24132
• e!Ensembl: ENSG00000104081

Protein

• UniProt ID: Q96LC9
• Protein name: Bcl-2-modifying factor
• Protein function: May play a role in apoptosis. Isoform 1 seems to be the main initiator.
• PDB: 7CNU, 8IQK, 8IQL, 8IQM, 8R58
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15185	BMF	1 → 184	Bcl-2-modifying factor, apoptosis	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells. {ECO:0000269|PubMed:14574334}.
• Sequence:

  MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
  RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
  PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
  AGPR

• Sequence length: 184

Pathways

KEGG:

MicroRNAs in cancer

Reactome:

BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
Activation of BMF and translocation to mitochondria

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyloidosis	Amyloidosis	BEFREE	29499358		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29499358, 30156339		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21673109, 27524613		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27035620		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20431602	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	30654331	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19671867, 30468466	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37794108	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19621425		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35435120	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	21593646		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	21593646		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22858545, 27524613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	23770605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	28112199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30754998		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27539959		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25321483, 25955657, 35627268	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22210314		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22210314		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29749531	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	27929686		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	27929686		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	30709661	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	28112199		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20861305	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35627268	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	30754998		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23403624, 30156339		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27035620		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26181206		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	36273157	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19244105	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	18354037	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	28112199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelofibrosis	Myelofibrosis	BEFREE	28159675		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26370254, 26914605, 27035620, 29437705		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38014922	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24488097		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	28159675		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29437705		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	28112199		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29749531		★☆☆☆☆ Found in Text Mining only