Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9040
Gene name	Ubiquitin conjugating enzyme E2 M
Gene symbol	UBE2M
Synonyms (NCBI Gene)	UBC-RS2UBC12hUbc12
Chromosome	19
Chromosome location	19q13.43
Summary	The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032277	hsa-let-7b-5p	Proteomics	18668040
MIRT048746	hsa-miR-93-5p	CLASH	23622248
MIRT1468322	hsa-miR-1254	CLIP-seq
MIRT1468323	hsa-miR-1827	CLIP-seq
MIRT1468324	hsa-miR-1908	CLIP-seq
MIRT1468325	hsa-miR-1909	CLIP-seq
MIRT1468326	hsa-miR-1912	CLIP-seq
MIRT1468327	hsa-miR-214	CLIP-seq
MIRT1468328	hsa-miR-296-5p	CLIP-seq
MIRT1468329	hsa-miR-3116	CLIP-seq
MIRT1468330	hsa-miR-3127-3p	CLIP-seq
MIRT1468331	hsa-miR-3130-5p	CLIP-seq
MIRT1468332	hsa-miR-3143	CLIP-seq
MIRT1468333	hsa-miR-34b	CLIP-seq
MIRT1468334	hsa-miR-3612	CLIP-seq
MIRT1468335	hsa-miR-3619-5p	CLIP-seq
MIRT1468336	hsa-miR-3649	CLIP-seq
MIRT1468337	hsa-miR-3940-5p	CLIP-seq
MIRT1468338	hsa-miR-4257	CLIP-seq
MIRT1468339	hsa-miR-4293	CLIP-seq
MIRT1468340	hsa-miR-4423-5p	CLIP-seq
MIRT1468341	hsa-miR-4456	CLIP-seq
MIRT1468342	hsa-miR-4481	CLIP-seq
MIRT1468343	hsa-miR-4482	CLIP-seq
MIRT1468344	hsa-miR-4488	CLIP-seq
MIRT1468345	hsa-miR-4507	CLIP-seq
MIRT1468346	hsa-miR-4530	CLIP-seq
MIRT1468347	hsa-miR-4648	CLIP-seq
MIRT1468348	hsa-miR-4651	CLIP-seq
MIRT1468349	hsa-miR-4656	CLIP-seq
MIRT1468350	hsa-miR-4694-5p	CLIP-seq
MIRT1468351	hsa-miR-4697-5p	CLIP-seq
MIRT1468352	hsa-miR-4717-3p	CLIP-seq
MIRT1468353	hsa-miR-4723-5p	CLIP-seq
MIRT1468354	hsa-miR-4745-5p	CLIP-seq
MIRT1468355	hsa-miR-4747-3p	CLIP-seq
MIRT1468356	hsa-miR-4758-5p	CLIP-seq
MIRT1468357	hsa-miR-4760-3p	CLIP-seq
MIRT1468358	hsa-miR-4787-3p	CLIP-seq
MIRT1468359	hsa-miR-4787-5p	CLIP-seq
MIRT1468360	hsa-miR-520a-5p	CLIP-seq
MIRT1468361	hsa-miR-525-5p	CLIP-seq
MIRT1468362	hsa-miR-541	CLIP-seq
MIRT1468363	hsa-miR-543	CLIP-seq
MIRT1468364	hsa-miR-579	CLIP-seq
MIRT1468365	hsa-miR-596	CLIP-seq
MIRT1468366	hsa-miR-608	CLIP-seq
MIRT1468367	hsa-miR-633	CLIP-seq
MIRT1468368	hsa-miR-650	CLIP-seq
MIRT1468369	hsa-miR-654-5p	CLIP-seq
MIRT1468370	hsa-miR-661	CLIP-seq
MIRT1468371	hsa-miR-663	CLIP-seq
MIRT1468372	hsa-miR-664	CLIP-seq
MIRT1468373	hsa-miR-761	CLIP-seq
MIRT1468374	hsa-miR-802	CLIP-seq
MIRT1468375	hsa-miR-885-3p	CLIP-seq
MIRT1468324	hsa-miR-1908	CLIP-seq
MIRT1468348	hsa-miR-4651	CLIP-seq
MIRT1468359	hsa-miR-4787-5p	CLIP-seq
MIRT1468366	hsa-miR-608	CLIP-seq
MIRT1468371	hsa-miR-663	CLIP-seq
MIRT1555317	hsa-miR-663b	CLIP-seq
MIRT1468330	hsa-miR-3127-3p	CLIP-seq
MIRT1468332	hsa-miR-3143	CLIP-seq
MIRT1468333	hsa-miR-34b	CLIP-seq
MIRT1468334	hsa-miR-3612	CLIP-seq
MIRT1468336	hsa-miR-3649	CLIP-seq
MIRT1468339	hsa-miR-4293	CLIP-seq
MIRT2140697	hsa-miR-4305	CLIP-seq
MIRT1468341	hsa-miR-4456	CLIP-seq
MIRT1468342	hsa-miR-4481	CLIP-seq
MIRT2140698	hsa-miR-4489	CLIP-seq
MIRT1468347	hsa-miR-4648	CLIP-seq
MIRT1468350	hsa-miR-4694-5p	CLIP-seq
MIRT1468352	hsa-miR-4717-3p	CLIP-seq
MIRT1468354	hsa-miR-4745-5p	CLIP-seq
MIRT1468357	hsa-miR-4760-3p	CLIP-seq
MIRT1468359	hsa-miR-4787-5p	CLIP-seq
MIRT1468362	hsa-miR-541	CLIP-seq
MIRT1468363	hsa-miR-543	CLIP-seq
MIRT1468364	hsa-miR-579	CLIP-seq
MIRT1468365	hsa-miR-596	CLIP-seq
MIRT1468367	hsa-miR-633	CLIP-seq
MIRT1468368	hsa-miR-650	CLIP-seq
MIRT1468369	hsa-miR-654-5p	CLIP-seq
MIRT1468372	hsa-miR-664	CLIP-seq
MIRT2361696	hsa-miR-1207-5p	CLIP-seq
MIRT1468322	hsa-miR-1254	CLIP-seq
MIRT1468324	hsa-miR-1908	CLIP-seq
MIRT1468325	hsa-miR-1909	CLIP-seq
MIRT1468326	hsa-miR-1912	CLIP-seq
MIRT1468327	hsa-miR-214	CLIP-seq
MIRT1468328	hsa-miR-296-5p	CLIP-seq
MIRT1468329	hsa-miR-3116	CLIP-seq
MIRT1468331	hsa-miR-3130-5p	CLIP-seq
MIRT2361697	hsa-miR-3179	CLIP-seq
MIRT2361698	hsa-miR-3202	CLIP-seq
MIRT1468334	hsa-miR-3612	CLIP-seq
MIRT1468335	hsa-miR-3619-5p	CLIP-seq
MIRT2361699	hsa-miR-3922-5p	CLIP-seq
MIRT2140697	hsa-miR-4305	CLIP-seq
MIRT1468340	hsa-miR-4423-5p	CLIP-seq
MIRT2361700	hsa-miR-4447	CLIP-seq
MIRT2361701	hsa-miR-4472	CLIP-seq
MIRT2361702	hsa-miR-4476	CLIP-seq
MIRT1468342	hsa-miR-4481	CLIP-seq
MIRT1468343	hsa-miR-4482	CLIP-seq
MIRT1468344	hsa-miR-4488	CLIP-seq
MIRT2140698	hsa-miR-4489	CLIP-seq
MIRT1468346	hsa-miR-4530	CLIP-seq
MIRT1468348	hsa-miR-4651	CLIP-seq
MIRT2361703	hsa-miR-4690-3p	CLIP-seq
MIRT1468351	hsa-miR-4697-5p	CLIP-seq
MIRT2361704	hsa-miR-4708-3p	CLIP-seq
MIRT2361705	hsa-miR-4736	CLIP-seq
MIRT1468354	hsa-miR-4745-5p	CLIP-seq
MIRT1468355	hsa-miR-4747-3p	CLIP-seq
MIRT2361706	hsa-miR-4753-5p	CLIP-seq
MIRT1468357	hsa-miR-4760-3p	CLIP-seq
MIRT2361707	hsa-miR-4763-3p	CLIP-seq
MIRT1468358	hsa-miR-4787-3p	CLIP-seq
MIRT1468359	hsa-miR-4787-5p	CLIP-seq
MIRT1468366	hsa-miR-608	CLIP-seq
MIRT1468368	hsa-miR-650	CLIP-seq
MIRT1468370	hsa-miR-661	CLIP-seq
MIRT1468371	hsa-miR-663	CLIP-seq
MIRT1555317	hsa-miR-663b	CLIP-seq
MIRT1468372	hsa-miR-664	CLIP-seq
MIRT2361708	hsa-miR-759	CLIP-seq
MIRT1468373	hsa-miR-761	CLIP-seq
MIRT1468338	hsa-miR-4257	CLIP-seq
MIRT1468360	hsa-miR-520a-5p	CLIP-seq
MIRT1468361	hsa-miR-525-5p	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IMP	15694336
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	9694792
GO:0005515	Function	Protein binding	IPI	15361859, 15694336, 17914462, 18264111, 18274552, 18805092, 18826954, 19250909, 19549727, 19617556, 19713960, 21145461, 21765416, 23201271, 24192928, 24949976, 25416956, 28514442, 28581483, 32296183, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0019787	Function	Ubiquitin-like protein transferase activity	IEA
GO:0019788	Function	NEDD8 transferase activity	IBA
GO:0019788	Function	NEDD8 transferase activity	IDA	19250909
GO:0019788	Function	NEDD8 transferase activity	TAS
GO:0032446	Process	Protein modification by small protein conjugation	IEA
GO:0036211	Process	Protein modification process	IMP	15694336
GO:0036211	Process	Protein modification process	TAS	9694792
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045116	Process	Protein neddylation	IBA
GO:0045116	Process	Protein neddylation	IDA	19250909
GO:0045116	Process	Protein neddylation	IEA
GO:0061654	Function	NEDD8 conjugating enzyme activity	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
603173	12491	ENSG00000130725

P61081

Protein name

NEDD8-conjugating enzyme Ubc12 (EC 2.3.2.34) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 M)

Protein function

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddyl

PDB

1TT5 , 1Y8X , 2NVU , 3TDU , 3TDZ , 4GAO , 4P5O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	33 → 168	Ubiquitin-conjugating enzyme	Domain

Sequence

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNF
KLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWK
PVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFER
CLK

Sequence length

183

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		TGF-beta receptor signaling activates SMADs Dectin-1 mediated noncanonical NF-kB signaling NIK-->noncanonical NF-kB signaling Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Barrett Esophagus	Barrett esophagus	Pubtator	33491460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36214767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31208947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30545630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37967839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26206335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30592156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34082605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31545502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35880551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29846044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36138144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31208947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30545630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30885218, 31782573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21477582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31545502		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30545630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30885218, 31782573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30885218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30341788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36138144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UBE2M (ubiquitin conjugating enzyme E2 M)