Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	90390
Gene name	Mediator complex subunit 30
Gene symbol	MED30
Synonyms (NCBI Gene)	MED30STHRAP6TRAP25
Chromosome	8
Chromosome location	8q24.11
Summary	The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 [PubMed 11909976]).[supplied by OMIM, Nov

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450262	hsa-miR-5584-5p	PAR-CLIP	22100165
MIRT450263	hsa-miR-3126-5p	PAR-CLIP	22100165
MIRT450261	hsa-miR-6875-5p	PAR-CLIP	22100165
MIRT450260	hsa-miR-4419a	PAR-CLIP	22100165
MIRT450259	hsa-miR-4510	PAR-CLIP	22100165
MIRT450258	hsa-miR-6127	PAR-CLIP	22100165
MIRT450257	hsa-miR-6129	PAR-CLIP	22100165
MIRT450256	hsa-miR-6130	PAR-CLIP	22100165
MIRT450255	hsa-miR-6133	PAR-CLIP	22100165
MIRT450254	hsa-miR-3148	PAR-CLIP	22100165
MIRT450252	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450253	hsa-miR-513a-5p	PAR-CLIP	22100165
MIRT450251	hsa-miR-27a-3p	PAR-CLIP	22100165
MIRT450250	hsa-miR-27b-3p	PAR-CLIP	22100165
MIRT450249	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT450248	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT450247	hsa-miR-6734-5p	PAR-CLIP	22100165
MIRT450262	hsa-miR-5584-5p	PAR-CLIP	22100165
MIRT450263	hsa-miR-3126-5p	PAR-CLIP	22100165
MIRT450261	hsa-miR-6875-5p	PAR-CLIP	22100165
MIRT450260	hsa-miR-4419a	PAR-CLIP	22100165
MIRT450259	hsa-miR-4510	PAR-CLIP	22100165
MIRT450258	hsa-miR-6127	PAR-CLIP	22100165
MIRT450257	hsa-miR-6129	PAR-CLIP	22100165
MIRT450256	hsa-miR-6130	PAR-CLIP	22100165
MIRT450255	hsa-miR-6133	PAR-CLIP	22100165
MIRT450254	hsa-miR-3148	PAR-CLIP	22100165
MIRT450252	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450253	hsa-miR-513a-5p	PAR-CLIP	22100165
MIRT450251	hsa-miR-27a-3p	PAR-CLIP	22100165
MIRT450250	hsa-miR-27b-3p	PAR-CLIP	22100165
MIRT450249	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT450248	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT450247	hsa-miR-6734-5p	PAR-CLIP	22100165
MIRT1141715	hsa-miR-1179	CLIP-seq
MIRT1141716	hsa-miR-27a	CLIP-seq
MIRT1141717	hsa-miR-27b	CLIP-seq
MIRT1141718	hsa-miR-3163	CLIP-seq
MIRT1141719	hsa-miR-412	CLIP-seq
MIRT1141720	hsa-miR-4778-3p	CLIP-seq
MIRT1141721	hsa-miR-577	CLIP-seq
MIRT1141716	hsa-miR-27a	CLIP-seq
MIRT1141717	hsa-miR-27b	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	IDA	10198638
GO:0003713	Function	Transcription coactivator activity	IDA	12218053
GO:0003713	Function	Transcription coactivator activity	NAS	10235266
GO:0005515	Function	Protein binding	IPI	21784977, 24981860, 25416956, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	10235267, 24882805
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016592	Component	Mediator complex	IBA
GO:0016592	Component	Mediator complex	IDA	10198638
GO:0016592	Component	Mediator complex	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	NAS	11559591
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0042809	Function	Nuclear vitamin D receptor binding	NAS	10235266
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10198638
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IDA	10198638
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	11559591
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	12218053
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	NAS	11559591
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070847	Component	Core mediator complex	IPI	24882805

MIM	HGNC	e!Ensembl
610237	23032	ENSG00000164758

Q96HR3

Protein name

Mediator of RNA polymerase II transcription subunit 30 (Mediator complex subunit 30) (TRAP/Mediator complex component TRAP25) (Thyroid hormone receptor-associated protein 6) (Thyroid hormone receptor-associated protein complex 25 kDa component) (Trap25)

Protein function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN

PDB

7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11315	Med30	29 → 176	Mediator complex subunit 30	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:11909976}.

Sequence

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEE
DGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

Sequence length

178

Interactions

View interactions

	KEGG		Reactome
	Thyroid hormone signaling pathway		PPARA activates gene expression Generic Transcription Pathway Transcriptional regulation of white adipocyte differentiation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE IDIOPATHIC SKELETAL HYPEROSTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY TRACT INFECTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESTIBULAR NEURONITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29187445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29661722		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of bladder	Bladder carcinoma	BEFREE	29187445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29661722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32705436	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32705436	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26110885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29187445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26110885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASDB_DG	22446961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASCAT_DG	22446961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	29187445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26110885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition Of Great Vessels	BEFREE	31255603		★★★★★ ★☆☆☆☆ Found in Text Mining only

MED30 (mediator complex subunit 30)