TAAR5 (trace amine associated receptor 5)

Gene

• Entrez ID: 9038
• Gene name: Trace amine associated receptor 5
• Gene symbol: TAAR5
• Synonyms (NCBI Gene): PNR, taR-5
• Chromosome: 6
• Chromosome location: 6q23.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001594	Function	Trace-amine receptor activity	IBA
GO:0001594	Function	Trace-amine receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9464258, 15718104
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	37225986
GO:0005886	Component	Plasma membrane	IDA	23393561
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9464258
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9464258
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15718104
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	23393561
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007606	Process	Sensory perception of chemical stimulus	IEA
GO:0007608	Process	Sensory perception of smell	ISS
GO:0016020	Component	Membrane	IEA
GO:0050890	Process	Cognition	IEA
GO:0050890	Process	Cognition	ISS
GO:1990081	Function	Trimethylamine receptor activity	IDA	23393561
GO:1990081	Function	Trimethylamine receptor activity	IEA

Other IDs

• MIM: 607405
• HGNC: 30236
• e!Ensembl: ENSG00000135569

Protein

• UniProt ID: O14804
• Protein name: Trace amine-associated receptor 5 (TaR-5) (Trace amine receptor 5) (hTaar5) (Putative neurotransmitter receptor)
• Protein function: Olfactory receptor specific for trimethylamine, a trace amine (PubMed:23393561). Also activated at lower level by dimethylethylamine (PubMed:23393561). Trimethylamine is a bacterial metabolite found in some animal odors, and to humans it is a re
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 305	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed almost exclusively in skeletal muscle and selected areas of the brain, such amygdala, hippocampus, caudate nucleus, thalamus and hypothalamus (PubMed:9464258). Weak expression is also find in substantia nigra (PubMed:9464258)
• Sequence:

  MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS
  YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT
  SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS
  QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL
  AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC
  NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE

• Sequence length: 337

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Amine ligand-binding receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Brain Diseases	Brain disease	Pubtator	34445502	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24747967		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	34445502	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34445502	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30986441		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	34445502	Associate	★☆☆☆☆ Found in Text Mining only
Enhanced S-Cone Syndrome	Enhanced S-Cone Syndrome	BEFREE	10655056		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31768862		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24747967		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35053262	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24747967		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28300834		★☆☆☆☆ Found in Text Mining only