SEMA5A (semaphorin 5A)

Gene

• Entrez ID: 9037
• Gene name: Semaphorin 5A
• Gene symbol: SEMA5A
• Synonyms (NCBI Gene): SEMAF, semF
• Chromosome: 5
• Chromosome location: 5p15.31
• Summary: This gene belongs to the semaphorin gene family that encodes membrane proteins containing a semaphorin domain and several thrombospondin type-1 repeats. Members of this family are involved in axonal guidance during neural development. This gene has been i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030970	hsa-miR-21-5p	Microarray	18591254
MIRT662456	hsa-miR-4714-3p	HITS-CLIP	23824327
MIRT662455	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT662454	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT662453	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT662452	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT662451	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT662450	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT662449	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT618541	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT618540	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT450677	hsa-miR-496	PAR-CLIP	22100165
MIRT450676	hsa-miR-8077	PAR-CLIP	22100165
MIRT445255	hsa-miR-144-3p	PAR-CLIP	22100165
MIRT445254	hsa-miR-3185	PAR-CLIP	22100165
MIRT445253	hsa-miR-4645-3p	PAR-CLIP	22100165
MIRT445252	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445255	hsa-miR-144-3p	PAR-CLIP	22100165
MIRT445254	hsa-miR-3185	PAR-CLIP	22100165
MIRT445253	hsa-miR-4645-3p	PAR-CLIP	22100165
MIRT445252	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445250	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445251	hsa-miR-4270	PAR-CLIP	22100165
MIRT445249	hsa-miR-4441	PAR-CLIP	22100165
MIRT445248	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445247	hsa-miR-6132	PAR-CLIP	22100165
MIRT445246	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445245	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445244	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445243	hsa-miR-6511b-5p	PAR-CLIP	22100165
MIRT445242	hsa-miR-6811-5p	PAR-CLIP	22100165
MIRT439683	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439683	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT734971	hsa-miR-330-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, In situ hybridization	33176280
MIRT662456	hsa-miR-4714-3p	HITS-CLIP	23824327
MIRT662455	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT662454	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT662453	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT662452	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT662451	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT662450	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT662449	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT618541	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT618540	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT450677	hsa-miR-496	PAR-CLIP	22100165
MIRT450676	hsa-miR-8077	PAR-CLIP	22100165
MIRT445255	hsa-miR-144-3p	PAR-CLIP	22100165
MIRT445254	hsa-miR-3185	PAR-CLIP	22100165
MIRT445253	hsa-miR-4645-3p	PAR-CLIP	22100165
MIRT445252	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445255	hsa-miR-144-3p	PAR-CLIP	22100165
MIRT445254	hsa-miR-3185	PAR-CLIP	22100165
MIRT445253	hsa-miR-4645-3p	PAR-CLIP	22100165
MIRT445252	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445250	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445251	hsa-miR-4270	PAR-CLIP	22100165
MIRT445249	hsa-miR-4441	PAR-CLIP	22100165
MIRT445248	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445247	hsa-miR-6132	PAR-CLIP	22100165
MIRT445246	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445245	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445244	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445243	hsa-miR-6511b-5p	PAR-CLIP	22100165
MIRT445242	hsa-miR-6811-5p	PAR-CLIP	22100165
MIRT1335297	hsa-miR-105	CLIP-seq
MIRT1335298	hsa-miR-106a	CLIP-seq
MIRT1335299	hsa-miR-106b	CLIP-seq
MIRT1335300	hsa-miR-1178	CLIP-seq
MIRT1335301	hsa-miR-1200	CLIP-seq
MIRT1335302	hsa-miR-1208	CLIP-seq
MIRT1335303	hsa-miR-1224-3p	CLIP-seq
MIRT1335304	hsa-miR-125a-3p	CLIP-seq
MIRT1335305	hsa-miR-1273e	CLIP-seq
MIRT1335306	hsa-miR-1284	CLIP-seq
MIRT1335307	hsa-miR-1292	CLIP-seq
MIRT1335308	hsa-miR-1305	CLIP-seq
MIRT1335309	hsa-miR-140-3p	CLIP-seq
MIRT1335310	hsa-miR-149	CLIP-seq
MIRT1335311	hsa-miR-150	CLIP-seq
MIRT1335312	hsa-miR-17	CLIP-seq
MIRT1335313	hsa-miR-186	CLIP-seq
MIRT1335314	hsa-miR-193a-3p	CLIP-seq
MIRT1335315	hsa-miR-193b	CLIP-seq
MIRT1335316	hsa-miR-198	CLIP-seq
MIRT1335317	hsa-miR-203	CLIP-seq
MIRT1335318	hsa-miR-204	CLIP-seq
MIRT1335319	hsa-miR-20a	CLIP-seq
MIRT1335320	hsa-miR-20b	CLIP-seq
MIRT1335321	hsa-miR-211	CLIP-seq
MIRT1335322	hsa-miR-2278	CLIP-seq
MIRT1335323	hsa-miR-24	CLIP-seq
MIRT1335324	hsa-miR-2467-3p	CLIP-seq
MIRT1335325	hsa-miR-302a	CLIP-seq
MIRT1335326	hsa-miR-302b	CLIP-seq
MIRT1335327	hsa-miR-302c	CLIP-seq
MIRT1335328	hsa-miR-302d	CLIP-seq
MIRT1335329	hsa-miR-302e	CLIP-seq
MIRT1335330	hsa-miR-3152-5p	CLIP-seq
MIRT1335331	hsa-miR-3179	CLIP-seq
MIRT1335332	hsa-miR-3180-5p	CLIP-seq
MIRT1335333	hsa-miR-3192	CLIP-seq
MIRT1335334	hsa-miR-335	CLIP-seq
MIRT1335335	hsa-miR-338-5p	CLIP-seq
MIRT1335336	hsa-miR-342-5p	CLIP-seq
MIRT1335337	hsa-miR-3622a-3p	CLIP-seq
MIRT1335338	hsa-miR-3622a-5p	CLIP-seq
MIRT1335339	hsa-miR-3622b-3p	CLIP-seq
MIRT1335340	hsa-miR-3649	CLIP-seq
MIRT1335341	hsa-miR-3661	CLIP-seq
MIRT1335342	hsa-miR-3663-5p	CLIP-seq
MIRT1335343	hsa-miR-3670	CLIP-seq
MIRT1335344	hsa-miR-3671	CLIP-seq
MIRT1335345	hsa-miR-3675-5p	CLIP-seq
MIRT1335346	hsa-miR-3678-3p	CLIP-seq
MIRT1335347	hsa-miR-371-5p	CLIP-seq
MIRT1335348	hsa-miR-371b-5p	CLIP-seq
MIRT1335349	hsa-miR-372	CLIP-seq
MIRT1335350	hsa-miR-373	CLIP-seq
MIRT1335351	hsa-miR-376c	CLIP-seq
MIRT1335352	hsa-miR-383	CLIP-seq
MIRT1335353	hsa-miR-3934	CLIP-seq
MIRT1335354	hsa-miR-3936	CLIP-seq
MIRT1335355	hsa-miR-3942-3p	CLIP-seq
MIRT1335356	hsa-miR-3973	CLIP-seq
MIRT1335357	hsa-miR-4257	CLIP-seq
MIRT1335358	hsa-miR-4269	CLIP-seq
MIRT1335359	hsa-miR-4276	CLIP-seq
MIRT1335360	hsa-miR-4284	CLIP-seq
MIRT1335361	hsa-miR-4300	CLIP-seq
MIRT1335362	hsa-miR-4320	CLIP-seq
MIRT1335363	hsa-miR-4324	CLIP-seq
MIRT1335364	hsa-miR-4423-5p	CLIP-seq
MIRT1335365	hsa-miR-4454	CLIP-seq
MIRT1335366	hsa-miR-4471	CLIP-seq
MIRT1335367	hsa-miR-4477a	CLIP-seq
MIRT1335368	hsa-miR-4503	CLIP-seq
MIRT1335369	hsa-miR-450b-5p	CLIP-seq
MIRT1335370	hsa-miR-4517	CLIP-seq
MIRT1335371	hsa-miR-4528	CLIP-seq
MIRT1335372	hsa-miR-4635	CLIP-seq
MIRT1335373	hsa-miR-4640-5p	CLIP-seq
MIRT1335374	hsa-miR-4651	CLIP-seq
MIRT1335375	hsa-miR-4664-5p	CLIP-seq
MIRT1335376	hsa-miR-4685-5p	CLIP-seq
MIRT1335377	hsa-miR-4711-5p	CLIP-seq
MIRT1335378	hsa-miR-4726-5p	CLIP-seq
MIRT1335379	hsa-miR-4731-5p	CLIP-seq
MIRT1335380	hsa-miR-4757-5p	CLIP-seq
MIRT1335381	hsa-miR-4771	CLIP-seq
MIRT1335382	hsa-miR-4772-5p	CLIP-seq
MIRT1335383	hsa-miR-4778-5p	CLIP-seq
MIRT1335384	hsa-miR-4786-5p	CLIP-seq
MIRT1335385	hsa-miR-4799-5p	CLIP-seq
MIRT1335386	hsa-miR-501-3p	CLIP-seq
MIRT1335387	hsa-miR-501-5p	CLIP-seq
MIRT1335388	hsa-miR-502-3p	CLIP-seq
MIRT1335389	hsa-miR-507	CLIP-seq
MIRT1335390	hsa-miR-508-5p	CLIP-seq
MIRT1335391	hsa-miR-512-3p	CLIP-seq
MIRT1335392	hsa-miR-512-5p	CLIP-seq
MIRT1335393	hsa-miR-513a-3p	CLIP-seq
MIRT1335394	hsa-miR-519a	CLIP-seq
MIRT1335395	hsa-miR-519b-3p	CLIP-seq
MIRT1335396	hsa-miR-519c-3p	CLIP-seq
MIRT1335397	hsa-miR-519d	CLIP-seq
MIRT1335398	hsa-miR-520a-3p	CLIP-seq
MIRT1335399	hsa-miR-520b	CLIP-seq
MIRT1335400	hsa-miR-520c-3p	CLIP-seq
MIRT1335401	hsa-miR-520d-3p	CLIP-seq
MIRT1335402	hsa-miR-520d-5p	CLIP-seq
MIRT1335403	hsa-miR-520e	CLIP-seq
MIRT1335404	hsa-miR-520g	CLIP-seq
MIRT1335405	hsa-miR-520h	CLIP-seq
MIRT1335406	hsa-miR-524-5p	CLIP-seq
MIRT1335407	hsa-miR-544b	CLIP-seq
MIRT1335408	hsa-miR-545	CLIP-seq
MIRT1335409	hsa-miR-548n	CLIP-seq
MIRT1335410	hsa-miR-548p	CLIP-seq
MIRT1335411	hsa-miR-548t	CLIP-seq
MIRT1335412	hsa-miR-557	CLIP-seq
MIRT1335413	hsa-miR-570	CLIP-seq
MIRT1335414	hsa-miR-577	CLIP-seq
MIRT1335415	hsa-miR-578	CLIP-seq
MIRT1335416	hsa-miR-587	CLIP-seq
MIRT1335417	hsa-miR-606	CLIP-seq
MIRT1335418	hsa-miR-607	CLIP-seq
MIRT1335419	hsa-miR-608	CLIP-seq
MIRT1335420	hsa-miR-631	CLIP-seq
MIRT1335421	hsa-miR-664	CLIP-seq
MIRT1335422	hsa-miR-759	CLIP-seq
MIRT1335423	hsa-miR-764	CLIP-seq
MIRT1335424	hsa-miR-767-5p	CLIP-seq
MIRT1335425	hsa-miR-873	CLIP-seq
MIRT1335426	hsa-miR-892b	CLIP-seq
MIRT1335427	hsa-miR-920	CLIP-seq
MIRT1335428	hsa-miR-93	CLIP-seq
MIRT1335301	hsa-miR-1200	CLIP-seq
MIRT2099129	hsa-miR-122	CLIP-seq
MIRT1335303	hsa-miR-1224-3p	CLIP-seq
MIRT1335304	hsa-miR-125a-3p	CLIP-seq
MIRT1335305	hsa-miR-1273e	CLIP-seq
MIRT1335313	hsa-miR-186	CLIP-seq
MIRT2099130	hsa-miR-2054	CLIP-seq
MIRT2099131	hsa-miR-2113	CLIP-seq
MIRT2099132	hsa-miR-2116	CLIP-seq
MIRT2099133	hsa-miR-2392	CLIP-seq
MIRT2099134	hsa-miR-298	CLIP-seq
MIRT2099135	hsa-miR-3133	CLIP-seq
MIRT2099136	hsa-miR-3182	CLIP-seq
MIRT2099137	hsa-miR-320a	CLIP-seq
MIRT2099138	hsa-miR-320b	CLIP-seq
MIRT2099139	hsa-miR-320c	CLIP-seq
MIRT2099140	hsa-miR-320d	CLIP-seq
MIRT2099141	hsa-miR-331-3p	CLIP-seq
MIRT2099142	hsa-miR-3607-3p	CLIP-seq
MIRT2099143	hsa-miR-3611	CLIP-seq
MIRT1335340	hsa-miR-3649	CLIP-seq
MIRT1335343	hsa-miR-3670	CLIP-seq
MIRT1335344	hsa-miR-3671	CLIP-seq
MIRT2099144	hsa-miR-3686	CLIP-seq
MIRT1335347	hsa-miR-371-5p	CLIP-seq
MIRT1335348	hsa-miR-371b-5p	CLIP-seq
MIRT2099145	hsa-miR-3913-3p	CLIP-seq
MIRT1335353	hsa-miR-3934	CLIP-seq
MIRT2099146	hsa-miR-3944-5p	CLIP-seq
MIRT1335363	hsa-miR-4324	CLIP-seq
MIRT2099147	hsa-miR-4429	CLIP-seq
MIRT2099148	hsa-miR-4446-3p	CLIP-seq
MIRT1335365	hsa-miR-4454	CLIP-seq
MIRT1335370	hsa-miR-4517	CLIP-seq
MIRT2099149	hsa-miR-451b	CLIP-seq
MIRT2099150	hsa-miR-4534	CLIP-seq
MIRT2099151	hsa-miR-4656	CLIP-seq
MIRT2099152	hsa-miR-4659a-3p	CLIP-seq
MIRT2099153	hsa-miR-4659b-3p	CLIP-seq
MIRT2099154	hsa-miR-4677-5p	CLIP-seq
MIRT2099155	hsa-miR-4744	CLIP-seq
MIRT2099156	hsa-miR-4762-3p	CLIP-seq
MIRT2099157	hsa-miR-4766-5p	CLIP-seq
MIRT1335385	hsa-miR-4799-5p	CLIP-seq
MIRT2099158	hsa-miR-489	CLIP-seq
MIRT2099159	hsa-miR-513c	CLIP-seq
MIRT2099160	hsa-miR-514b-5p	CLIP-seq
MIRT1335407	hsa-miR-544b	CLIP-seq
MIRT2099161	hsa-miR-579	CLIP-seq
MIRT1335416	hsa-miR-587	CLIP-seq
MIRT2099162	hsa-miR-758	CLIP-seq
MIRT1335423	hsa-miR-764	CLIP-seq
MIRT2099163	hsa-miR-891b	CLIP-seq
MIRT2099164	hsa-miR-942	CLIP-seq
MIRT2323880	hsa-miR-1180	CLIP-seq
MIRT2099129	hsa-miR-122	CLIP-seq
MIRT2323881	hsa-miR-1225-5p	CLIP-seq
MIRT2323882	hsa-miR-1236	CLIP-seq
MIRT1335304	hsa-miR-125a-3p	CLIP-seq
MIRT2323883	hsa-miR-1273g	CLIP-seq
MIRT2323884	hsa-miR-128	CLIP-seq
MIRT2323885	hsa-miR-1289	CLIP-seq
MIRT2323886	hsa-miR-1324	CLIP-seq
MIRT2323887	hsa-miR-1343	CLIP-seq
MIRT1335309	hsa-miR-140-3p	CLIP-seq
MIRT2323888	hsa-miR-140-5p	CLIP-seq
MIRT2323889	hsa-miR-141	CLIP-seq
MIRT2323890	hsa-miR-143	CLIP-seq
MIRT1335311	hsa-miR-150	CLIP-seq
MIRT2323891	hsa-miR-155	CLIP-seq
MIRT1335313	hsa-miR-186	CLIP-seq
MIRT2323892	hsa-miR-1909	CLIP-seq
MIRT2323893	hsa-miR-1972	CLIP-seq
MIRT2323894	hsa-miR-200a	CLIP-seq
MIRT1335317	hsa-miR-203	CLIP-seq
MIRT2323895	hsa-miR-2052	CLIP-seq
MIRT2099130	hsa-miR-2054	CLIP-seq
MIRT2099131	hsa-miR-2113	CLIP-seq
MIRT2323896	hsa-miR-214	CLIP-seq
MIRT2323897	hsa-miR-224	CLIP-seq
MIRT1335322	hsa-miR-2278	CLIP-seq
MIRT2099133	hsa-miR-2392	CLIP-seq
MIRT2323898	hsa-miR-28-5p	CLIP-seq
MIRT2099134	hsa-miR-298	CLIP-seq
MIRT2323899	hsa-miR-3064-3p	CLIP-seq
MIRT2323900	hsa-miR-3074-3p	CLIP-seq
MIRT2323901	hsa-miR-31	CLIP-seq
MIRT2099135	hsa-miR-3133	CLIP-seq
MIRT2323902	hsa-miR-3138	CLIP-seq
MIRT2323903	hsa-miR-3139	CLIP-seq
MIRT2099136	hsa-miR-3182	CLIP-seq
MIRT2323904	hsa-miR-3198	CLIP-seq
MIRT2099137	hsa-miR-320a	CLIP-seq
MIRT2099138	hsa-miR-320b	CLIP-seq
MIRT2099139	hsa-miR-320c	CLIP-seq
MIRT2099140	hsa-miR-320d	CLIP-seq
MIRT1335334	hsa-miR-335	CLIP-seq
MIRT2099142	hsa-miR-3607-3p	CLIP-seq
MIRT2099143	hsa-miR-3611	CLIP-seq
MIRT2323905	hsa-miR-3613-5p	CLIP-seq
MIRT2323906	hsa-miR-361-5p	CLIP-seq
MIRT2323907	hsa-miR-3616-5p	CLIP-seq
MIRT2323908	hsa-miR-3619-3p	CLIP-seq
MIRT2323909	hsa-miR-3619-5p	CLIP-seq
MIRT1335338	hsa-miR-3622a-5p	CLIP-seq
MIRT2323910	hsa-miR-3622b-5p	CLIP-seq
MIRT2323911	hsa-miR-3647-5p	CLIP-seq
MIRT1335340	hsa-miR-3649	CLIP-seq
MIRT1335341	hsa-miR-3661	CLIP-seq
MIRT2099144	hsa-miR-3686	CLIP-seq
MIRT2323912	hsa-miR-3690	CLIP-seq
MIRT1335348	hsa-miR-371b-5p	CLIP-seq
MIRT2323913	hsa-miR-3908	CLIP-seq
MIRT2323914	hsa-miR-3910	CLIP-seq
MIRT2323915	hsa-miR-3911	CLIP-seq
MIRT2323916	hsa-miR-3919	CLIP-seq
MIRT1335353	hsa-miR-3934	CLIP-seq
MIRT1335355	hsa-miR-3942-3p	CLIP-seq
MIRT2323917	hsa-miR-409-3p	CLIP-seq
MIRT2323918	hsa-miR-4254	CLIP-seq
MIRT1335357	hsa-miR-4257	CLIP-seq
MIRT1335358	hsa-miR-4269	CLIP-seq
MIRT2323919	hsa-miR-4291	CLIP-seq
MIRT2323920	hsa-miR-4294	CLIP-seq
MIRT2323921	hsa-miR-4309	CLIP-seq
MIRT2323922	hsa-miR-4325	CLIP-seq
MIRT2099147	hsa-miR-4429	CLIP-seq
MIRT2323923	hsa-miR-4432	CLIP-seq
MIRT2323924	hsa-miR-4436a	CLIP-seq
MIRT2323925	hsa-miR-4436b-3p	CLIP-seq
MIRT1335366	hsa-miR-4471	CLIP-seq
MIRT2323926	hsa-miR-4497	CLIP-seq
MIRT2323927	hsa-miR-451	CLIP-seq
MIRT2323928	hsa-miR-4514	CLIP-seq
MIRT2099150	hsa-miR-4534	CLIP-seq
MIRT2323929	hsa-miR-4535	CLIP-seq
MIRT2323930	hsa-miR-4645-5p	CLIP-seq
MIRT2323931	hsa-miR-4664-3p	CLIP-seq
MIRT2323932	hsa-miR-4673	CLIP-seq
MIRT2323933	hsa-miR-4692	CLIP-seq
MIRT2323934	hsa-miR-4715-3p	CLIP-seq
MIRT2323935	hsa-miR-4719	CLIP-seq
MIRT2323936	hsa-miR-4738-3p	CLIP-seq
MIRT2323937	hsa-miR-4742-5p	CLIP-seq
MIRT2099155	hsa-miR-4744	CLIP-seq
MIRT2323938	hsa-miR-4756-3p	CLIP-seq
MIRT2323939	hsa-miR-4761-3p	CLIP-seq
MIRT2323940	hsa-miR-4770	CLIP-seq
MIRT1335381	hsa-miR-4771	CLIP-seq
MIRT2323941	hsa-miR-4776-5p	CLIP-seq
MIRT2323942	hsa-miR-4795-5p	CLIP-seq
MIRT2323943	hsa-miR-4797-5p	CLIP-seq
MIRT2323944	hsa-miR-4800-5p	CLIP-seq
MIRT2323945	hsa-miR-492	CLIP-seq
MIRT2323946	hsa-miR-499-3p	CLIP-seq
MIRT2323947	hsa-miR-499a-3p	CLIP-seq
MIRT1335386	hsa-miR-501-3p	CLIP-seq
MIRT1335388	hsa-miR-502-3p	CLIP-seq
MIRT1335393	hsa-miR-513a-3p	CLIP-seq
MIRT2323948	hsa-miR-513b	CLIP-seq
MIRT2323949	hsa-miR-516a-3p	CLIP-seq
MIRT1335409	hsa-miR-548n	CLIP-seq
MIRT1335411	hsa-miR-548t	CLIP-seq
MIRT2323950	hsa-miR-552	CLIP-seq
MIRT2323951	hsa-miR-561	CLIP-seq
MIRT2323952	hsa-miR-573	CLIP-seq
MIRT1335415	hsa-miR-578	CLIP-seq
MIRT2323953	hsa-miR-617	CLIP-seq
MIRT1335420	hsa-miR-631	CLIP-seq
MIRT2323954	hsa-miR-640	CLIP-seq
MIRT2323955	hsa-miR-708	CLIP-seq
MIRT2323956	hsa-miR-760	CLIP-seq
MIRT2323957	hsa-miR-761	CLIP-seq
MIRT1335423	hsa-miR-764	CLIP-seq
MIRT1335424	hsa-miR-767-5p	CLIP-seq
MIRT2323958	hsa-miR-876-3p	CLIP-seq
MIRT2323959	hsa-miR-922	CLIP-seq
MIRT2323887	hsa-miR-1343	CLIP-seq
MIRT2323918	hsa-miR-4254	CLIP-seq
MIRT2323949	hsa-miR-516a-3p	CLIP-seq
MIRT2432967	hsa-miR-1207-3p	CLIP-seq
MIRT2323895	hsa-miR-2052	CLIP-seq
MIRT1335322	hsa-miR-2278	CLIP-seq
MIRT1335334	hsa-miR-335	CLIP-seq
MIRT2432968	hsa-miR-3692	CLIP-seq
MIRT2432969	hsa-miR-4490	CLIP-seq
MIRT1335386	hsa-miR-501-3p	CLIP-seq
MIRT1335388	hsa-miR-502-3p	CLIP-seq
MIRT1335424	hsa-miR-767-5p	CLIP-seq
MIRT2440119	hsa-miR-188-3p	CLIP-seq
MIRT1335387	hsa-miR-501-5p	CLIP-seq
MIRT2440120	hsa-miR-532-3p	CLIP-seq
MIRT1335416	hsa-miR-587	CLIP-seq
MIRT2619761	hsa-miR-1183	CLIP-seq
MIRT2619762	hsa-miR-1185	CLIP-seq
MIRT1335303	hsa-miR-1224-3p	CLIP-seq
MIRT1335304	hsa-miR-125a-3p	CLIP-seq
MIRT2619763	hsa-miR-1273f	CLIP-seq
MIRT1335311	hsa-miR-150	CLIP-seq
MIRT1335313	hsa-miR-186	CLIP-seq
MIRT2440119	hsa-miR-188-3p	CLIP-seq
MIRT1335318	hsa-miR-204	CLIP-seq
MIRT2323895	hsa-miR-2052	CLIP-seq
MIRT2099130	hsa-miR-2054	CLIP-seq
MIRT1335321	hsa-miR-211	CLIP-seq
MIRT2323896	hsa-miR-214	CLIP-seq
MIRT1335322	hsa-miR-2278	CLIP-seq
MIRT2619764	hsa-miR-2467-5p	CLIP-seq
MIRT2619765	hsa-miR-296-3p	CLIP-seq
MIRT2619766	hsa-miR-3127-5p	CLIP-seq
MIRT2099135	hsa-miR-3133	CLIP-seq
MIRT2619767	hsa-miR-3140-3p	CLIP-seq
MIRT2099136	hsa-miR-3182	CLIP-seq
MIRT2619768	hsa-miR-3188	CLIP-seq
MIRT2099137	hsa-miR-320a	CLIP-seq
MIRT2099138	hsa-miR-320b	CLIP-seq
MIRT2099139	hsa-miR-320c	CLIP-seq
MIRT2099140	hsa-miR-320d	CLIP-seq
MIRT2619769	hsa-miR-330-3p	CLIP-seq
MIRT1335334	hsa-miR-335	CLIP-seq
MIRT2619770	hsa-miR-340	CLIP-seq
MIRT2619771	hsa-miR-3605-5p	CLIP-seq
MIRT2099142	hsa-miR-3607-3p	CLIP-seq
MIRT2619772	hsa-miR-3613-3p	CLIP-seq
MIRT2323907	hsa-miR-3616-5p	CLIP-seq
MIRT2323909	hsa-miR-3619-5p	CLIP-seq
MIRT2323911	hsa-miR-3647-5p	CLIP-seq
MIRT1335343	hsa-miR-3670	CLIP-seq
MIRT2619773	hsa-miR-3676	CLIP-seq
MIRT1335346	hsa-miR-3678-3p	CLIP-seq
MIRT2619774	hsa-miR-3679-3p	CLIP-seq
MIRT2619775	hsa-miR-3679-5p	CLIP-seq
MIRT2099144	hsa-miR-3686	CLIP-seq
MIRT2619776	hsa-miR-369-3p	CLIP-seq
MIRT1335347	hsa-miR-371-5p	CLIP-seq
MIRT1335348	hsa-miR-371b-5p	CLIP-seq
MIRT2619777	hsa-miR-374a	CLIP-seq
MIRT2619778	hsa-miR-374b	CLIP-seq
MIRT2619779	hsa-miR-374c	CLIP-seq
MIRT2619780	hsa-miR-375	CLIP-seq
MIRT1335353	hsa-miR-3934	CLIP-seq
MIRT2619781	hsa-miR-3938	CLIP-seq
MIRT2619782	hsa-miR-3975	CLIP-seq
MIRT2323919	hsa-miR-4291	CLIP-seq
MIRT2619783	hsa-miR-432	CLIP-seq
MIRT2099147	hsa-miR-4429	CLIP-seq
MIRT1335365	hsa-miR-4454	CLIP-seq
MIRT1335369	hsa-miR-450b-5p	CLIP-seq
MIRT2619784	hsa-miR-4519	CLIP-seq
MIRT2619785	hsa-miR-4649-3p	CLIP-seq
MIRT2619786	hsa-miR-4663	CLIP-seq
MIRT2619787	hsa-miR-4666-3p	CLIP-seq
MIRT2619788	hsa-miR-4699-3p	CLIP-seq
MIRT2323935	hsa-miR-4719	CLIP-seq
MIRT2619789	hsa-miR-4731-3p	CLIP-seq
MIRT2323936	hsa-miR-4738-3p	CLIP-seq
MIRT2099155	hsa-miR-4744	CLIP-seq
MIRT2619790	hsa-miR-4755-5p	CLIP-seq
MIRT1335380	hsa-miR-4757-5p	CLIP-seq
MIRT2619791	hsa-miR-4780	CLIP-seq
MIRT2323942	hsa-miR-4795-5p	CLIP-seq
MIRT2619792	hsa-miR-4801	CLIP-seq
MIRT2619793	hsa-miR-4803	CLIP-seq
MIRT2619794	hsa-miR-485-5p	CLIP-seq
MIRT1335386	hsa-miR-501-3p	CLIP-seq
MIRT1335387	hsa-miR-501-5p	CLIP-seq
MIRT1335388	hsa-miR-502-3p	CLIP-seq
MIRT1335389	hsa-miR-507	CLIP-seq
MIRT1335391	hsa-miR-512-3p	CLIP-seq
MIRT1335392	hsa-miR-512-5p	CLIP-seq
MIRT2099159	hsa-miR-513c	CLIP-seq
MIRT2099160	hsa-miR-514b-5p	CLIP-seq
MIRT2619795	hsa-miR-548g	CLIP-seq
MIRT1335412	hsa-miR-557	CLIP-seq
MIRT2323952	hsa-miR-573	CLIP-seq
MIRT1335416	hsa-miR-587	CLIP-seq
MIRT2619796	hsa-miR-623	CLIP-seq
MIRT2619797	hsa-miR-655	CLIP-seq
MIRT2323957	hsa-miR-761	CLIP-seq
MIRT1335423	hsa-miR-764	CLIP-seq
MIRT1335424	hsa-miR-767-5p	CLIP-seq
MIRT2619798	hsa-miR-885-3p	CLIP-seq
MIRT2323959	hsa-miR-922	CLIP-seq
MIRT2619799	hsa-miR-941	CLIP-seq
MIRT2619761	hsa-miR-1183	CLIP-seq
MIRT2619762	hsa-miR-1185	CLIP-seq
MIRT2432967	hsa-miR-1207-3p	CLIP-seq
MIRT1335303	hsa-miR-1224-3p	CLIP-seq
MIRT2323882	hsa-miR-1236	CLIP-seq
MIRT1335304	hsa-miR-125a-3p	CLIP-seq
MIRT2619763	hsa-miR-1273f	CLIP-seq
MIRT2440119	hsa-miR-188-3p	CLIP-seq
MIRT1335318	hsa-miR-204	CLIP-seq
MIRT2323895	hsa-miR-2052	CLIP-seq
MIRT2099130	hsa-miR-2054	CLIP-seq
MIRT1335321	hsa-miR-211	CLIP-seq
MIRT2323896	hsa-miR-214	CLIP-seq
MIRT2690368	hsa-miR-219-1-3p	CLIP-seq
MIRT1335322	hsa-miR-2278	CLIP-seq
MIRT2690369	hsa-miR-2355-5p	CLIP-seq
MIRT2619764	hsa-miR-2467-5p	CLIP-seq
MIRT2619765	hsa-miR-296-3p	CLIP-seq
MIRT2619767	hsa-miR-3140-3p	CLIP-seq
MIRT2099136	hsa-miR-3182	CLIP-seq
MIRT2619768	hsa-miR-3188	CLIP-seq
MIRT2690370	hsa-miR-3200-5p	CLIP-seq
MIRT2099137	hsa-miR-320a	CLIP-seq
MIRT2099138	hsa-miR-320b	CLIP-seq
MIRT2099139	hsa-miR-320c	CLIP-seq
MIRT2099140	hsa-miR-320d	CLIP-seq
MIRT2619769	hsa-miR-330-3p	CLIP-seq
MIRT1335334	hsa-miR-335	CLIP-seq
MIRT2619770	hsa-miR-340	CLIP-seq
MIRT2619771	hsa-miR-3605-5p	CLIP-seq
MIRT2099142	hsa-miR-3607-3p	CLIP-seq
MIRT2619772	hsa-miR-3613-3p	CLIP-seq
MIRT2323907	hsa-miR-3616-5p	CLIP-seq
MIRT2323909	hsa-miR-3619-5p	CLIP-seq
MIRT2323911	hsa-miR-3647-5p	CLIP-seq
MIRT2690371	hsa-miR-3665	CLIP-seq
MIRT1335343	hsa-miR-3670	CLIP-seq
MIRT2619773	hsa-miR-3676	CLIP-seq
MIRT1335346	hsa-miR-3678-3p	CLIP-seq
MIRT2619774	hsa-miR-3679-3p	CLIP-seq
MIRT2619775	hsa-miR-3679-5p	CLIP-seq
MIRT2099144	hsa-miR-3686	CLIP-seq
MIRT2432968	hsa-miR-3692	CLIP-seq
MIRT2619776	hsa-miR-369-3p	CLIP-seq
MIRT1335347	hsa-miR-371-5p	CLIP-seq
MIRT1335348	hsa-miR-371b-5p	CLIP-seq
MIRT2619777	hsa-miR-374a	CLIP-seq
MIRT2619778	hsa-miR-374b	CLIP-seq
MIRT2619779	hsa-miR-374c	CLIP-seq
MIRT2619780	hsa-miR-375	CLIP-seq
MIRT2690372	hsa-miR-384	CLIP-seq
MIRT1335353	hsa-miR-3934	CLIP-seq
MIRT2619781	hsa-miR-3938	CLIP-seq
MIRT2619782	hsa-miR-3975	CLIP-seq
MIRT1335357	hsa-miR-4257	CLIP-seq
MIRT2690373	hsa-miR-4290	CLIP-seq
MIRT2323919	hsa-miR-4291	CLIP-seq
MIRT2690374	hsa-miR-4297	CLIP-seq
MIRT2619783	hsa-miR-432	CLIP-seq
MIRT1335364	hsa-miR-4423-5p	CLIP-seq
MIRT2099147	hsa-miR-4429	CLIP-seq
MIRT1335365	hsa-miR-4454	CLIP-seq
MIRT2432969	hsa-miR-4490	CLIP-seq
MIRT1335369	hsa-miR-450b-5p	CLIP-seq
MIRT2619784	hsa-miR-4519	CLIP-seq
MIRT2690375	hsa-miR-4530	CLIP-seq
MIRT2619785	hsa-miR-4649-3p	CLIP-seq
MIRT2619786	hsa-miR-4663	CLIP-seq
MIRT2619787	hsa-miR-4666-3p	CLIP-seq
MIRT2619788	hsa-miR-4699-3p	CLIP-seq
MIRT2690376	hsa-miR-4713-5p	CLIP-seq
MIRT2323935	hsa-miR-4719	CLIP-seq
MIRT2619789	hsa-miR-4731-3p	CLIP-seq
MIRT2323936	hsa-miR-4738-3p	CLIP-seq
MIRT2619790	hsa-miR-4755-5p	CLIP-seq
MIRT1335380	hsa-miR-4757-5p	CLIP-seq
MIRT2099157	hsa-miR-4766-5p	CLIP-seq
MIRT2619791	hsa-miR-4780	CLIP-seq
MIRT2323942	hsa-miR-4795-5p	CLIP-seq
MIRT2619792	hsa-miR-4801	CLIP-seq
MIRT2619793	hsa-miR-4803	CLIP-seq
MIRT2619794	hsa-miR-485-5p	CLIP-seq
MIRT1335386	hsa-miR-501-3p	CLIP-seq
MIRT1335387	hsa-miR-501-5p	CLIP-seq
MIRT1335388	hsa-miR-502-3p	CLIP-seq
MIRT1335389	hsa-miR-507	CLIP-seq
MIRT1335391	hsa-miR-512-3p	CLIP-seq
MIRT1335392	hsa-miR-512-5p	CLIP-seq
MIRT2099159	hsa-miR-513c	CLIP-seq
MIRT2099160	hsa-miR-514b-5p	CLIP-seq
MIRT2440120	hsa-miR-532-3p	CLIP-seq
MIRT2690377	hsa-miR-548a-3p	CLIP-seq
MIRT2690378	hsa-miR-548e	CLIP-seq
MIRT2690379	hsa-miR-548f	CLIP-seq
MIRT2619795	hsa-miR-548g	CLIP-seq
MIRT1335412	hsa-miR-557	CLIP-seq
MIRT2690380	hsa-miR-571	CLIP-seq
MIRT2323952	hsa-miR-573	CLIP-seq
MIRT1335414	hsa-miR-577	CLIP-seq
MIRT1335416	hsa-miR-587	CLIP-seq
MIRT2619796	hsa-miR-623	CLIP-seq
MIRT2690381	hsa-miR-636	CLIP-seq
MIRT2690382	hsa-miR-642b	CLIP-seq
MIRT2619797	hsa-miR-655	CLIP-seq
MIRT2323957	hsa-miR-761	CLIP-seq
MIRT1335423	hsa-miR-764	CLIP-seq
MIRT1335424	hsa-miR-767-5p	CLIP-seq
MIRT2619798	hsa-miR-885-3p	CLIP-seq
MIRT2323959	hsa-miR-922	CLIP-seq
MIRT2619799	hsa-miR-941	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IBA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	ISS
GO:0002043	Process	Blood vessel endothelial cell proliferation involved in sprouting angiogenesis	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	TAS	9049630
GO:0007162	Process	Negative regulation of cell adhesion	ISS
GO:0007267	Process	Cell-cell signaling	TAS	9464278
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	9464278
GO:0007411	Process	Axon guidance	IBA
GO:0007413	Process	Axonal fasciculation	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0021536	Process	Diencephalon development	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030215	Function	Semaphorin receptor binding	IBA
GO:0030215	Function	Semaphorin receptor binding	IEA
GO:0030215	Function	Semaphorin receptor binding	ISS
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030836	Process	Positive regulation of actin filament depolymerization	ISS
GO:0035373	Function	Chondroitin sulfate proteoglycan binding	ISS
GO:0043395	Function	Heparan sulfate proteoglycan binding	ISS
GO:0045499	Function	Chemorepellent activity	IBA
GO:0045545	Function	Syndecan binding	ISS
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0048675	Process	Axon extension	IBA
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	ISS
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	ISS
GO:0050918	Process	Positive chemotaxis	ISS
GO:0050919	Process	Negative chemotaxis	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060326	Process	Cell chemotaxis	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	ISS
GO:1990256	Process	Signal clustering	ISS
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	ISS
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	ISS

Other IDs

• MIM: 609297
• HGNC: 10736
• e!Ensembl: ENSG00000112902

Protein

• UniProt ID: Q13591
• Protein name: Semaphorin-5A (Semaphorin-F) (Sema F)
• Protein function: Bifunctional axonal guidance cue regulated by sulfated proteoglycans; attractive effects result from interactions with heparan sulfate proteoglycans (HSPGs), while the inhibitory effects depend on interactions with chondroitin sulfate proteoglyc
• PDB: 8CKG, 8CKK, 8CKL, 8CKM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01403	Sema	60 → 466	Sema domain	Family
  PF00090	TSP_1	599 → 650	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	657 → 701	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	788 → 838	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	845 → 895	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	900 → 944	Thrombospondin type 1 domain	Domain

• Sequence:

  MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQ
  LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
  LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
  AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
  DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
  DLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTV
  DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII
  YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVV
  KIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
  GHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTP
  WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
  PWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISD
  NGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
  HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
  DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
  EWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
  KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
  HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY

• Sequence length: 1074

Pathways

KEGG:

Axon guidance

Reactome:

Other semaphorin interactions
Defective B3GALTL causes Peters-plus syndrome (PpS)
O-glycosylation of TSR domain-containing proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOPHTHALMOS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHARCOT-MARIE-TOOTH DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infantile epilepsy syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFECTIOUS ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LATE-ONSET MYASTHENIA GRAVIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY HYPOGONADISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEMA5A-associated Neurodevelopmental syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEMA5A-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31789397		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28626864	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35835748	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21706053		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23575222, 26395558	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23575222, 26395558, 29209394, 31509188		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	17028446, 19812673, 23575222, 26601658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	17028446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17028446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	17028446, 19812673	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	23575222	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28063160, 28912336		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28063160	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	32860660	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22789435		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31275094		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29977159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	29977159		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASDB_DG	23829686		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31509188		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28607584		★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cri-du-Chat Syndrome	5p partial monosomy syndrome	BEFREE	16953888		★☆☆☆☆ Found in Text Mining only
Cri-du-Chat Syndrome	5p partial monosomy syndrome	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30598261	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37916327	Inhibit	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31544715		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	28063160	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20696765, 21706053		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	30592759	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31509188		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	32860660	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	16953888, 26395558		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Intellectual developmental disorder	Pubtator	26395558	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30592759	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30592759	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28063160	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39563449	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28063160		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28063160	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	39563449	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19522033	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31544715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22789435		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20073063, 22782341, 29464045, 29977159, 30577767		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20026339, 22821546, 23661031		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22789435, 22821546, 23661031		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29977159		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28607584		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27171439, 30454024		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27171439	Associate	★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	16953888		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Monosomy 5p	Monosomy 5p	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Monosomy 5p	Monosomy 5p	Orphanet			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31597158		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	GWASCAT_DG	26562150		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12174360, 20073063, 20802022, 22782341, 29464045, 29977159, 30577767		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	28063160		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	25648254	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20802022		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20073063, 22782341, 29464045, 29977159, 30577767		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	20073063		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	16252231	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	16481103, 18950607, 24706317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	18950607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	26395558		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	28063160	Stimulate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	30592759		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	37661009	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19522033, 20026339, 22821546, 23661031		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19522033	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22821546	Stimulate	★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33176280	Associate	★☆☆☆☆ Found in Text Mining only