CCRL2 (C-C motif chemokine receptor like 2)

Gene

• Entrez ID: 9034
• Gene name: C-C motif chemokine receptor like 2
• Gene symbol: CCRL2
• Synonyms (NCBI Gene): ACKR5, CKRX, CRAM, CRAM-A, CRAM-B, HCR
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT662225	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT662224	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT662223	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT662222	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662220	hsa-miR-4469	HITS-CLIP	23824327
MIRT662221	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT662219	hsa-miR-4287	HITS-CLIP	23824327
MIRT662218	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT662217	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT662216	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT662215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT662214	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT662213	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT662212	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT662211	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT662210	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT662225	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT662224	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT662223	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT662222	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662220	hsa-miR-4469	HITS-CLIP	23824327
MIRT662221	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT662219	hsa-miR-4287	HITS-CLIP	23824327
MIRT662218	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT662217	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT662216	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT662215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT662214	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT662213	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT662212	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT662211	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT662210	hsa-miR-4659b-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	9473515
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IDA	20002784
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9473515
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9473515
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	ISS
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9473515
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0042379	Function	Chemokine receptor binding	IPI	14530373
GO:0048020	Function	CCR chemokine receptor binding	IPI	20002784
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

Other IDs

• MIM: 608379
• HGNC: 1612
• e!Ensembl: ENSG00000121797

Protein

• UniProt ID: O00421
• Protein name: C-C chemokine receptor-like 2 (Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)
• Protein function: Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functio
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	55 → 300	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (bot
• Sequence:

  MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV
  LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF
  NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK
  CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV
  FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY
  AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

• Sequence length: 344

Pathways

Reactome:

Chemokine receptors bind chemokines

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31484658		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	25340798		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	29284378, 30967799, 31096835		★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28743719		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15188357	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	17340018		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26563945		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31484658		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27907906	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20130232		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33910576	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20453841		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	14675183		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28600126		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	2702567		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28600126		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27793847		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27793847		★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	21710610, 25295466		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31733653		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27258612, 35179961	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24695578	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26563945		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31484658		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35179961	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28600126		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30131743		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28233070		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38167332	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38167332	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10888604, 11348465, 11875053, 14675183, 15190014, 15214895, 16134125, 17340018, 19551138		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	12648227, 15214895, 16141233		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30131743		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	9459162		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15188357, 18025126, 20453841		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15188357		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	30131743		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27907906		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35754051	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24695578	Associate	★☆☆☆☆ Found in Text Mining only