HIP1R (huntingtin interacting protein 1 related)

Gene

• Entrez ID: 9026
• Gene name: Huntingtin interacting protein 1 related
• Gene symbol: HIP1R
• Synonyms (NCBI Gene): HIP12, HIP3, ILWEQ
• Chromosome: 12
• Chromosome location: 12q24.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018313	hsa-miR-335-5p	Microarray	18185580
MIRT049108	hsa-miR-92a-3p	CLASH	23622248
MIRT045883	hsa-miR-128-3p	CLASH	23622248
MIRT440504	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT440504	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT731581	hsa-miR-23a-3p	Luciferase reporter assay	26898757
MIRT731581	hsa-miR-23a-3p	Luciferase reporter assay	26898757
MIRT731582	hsa-miR-27b-3p	Luciferase reporter assay	26898757
MIRT731582	hsa-miR-27b-3p	Luciferase reporter assay	26898757
MIRT1046375	hsa-miR-106a	CLIP-seq
MIRT1046376	hsa-miR-106b	CLIP-seq
MIRT1046377	hsa-miR-1285	CLIP-seq
MIRT1046378	hsa-miR-132	CLIP-seq
MIRT1046379	hsa-miR-137	CLIP-seq
MIRT1046380	hsa-miR-17	CLIP-seq
MIRT1046381	hsa-miR-20a	CLIP-seq
MIRT1046382	hsa-miR-20b	CLIP-seq
MIRT1046383	hsa-miR-212	CLIP-seq
MIRT1046384	hsa-miR-3065-5p	CLIP-seq
MIRT1046385	hsa-miR-3119	CLIP-seq
MIRT1046386	hsa-miR-3187-5p	CLIP-seq
MIRT1046387	hsa-miR-3671	CLIP-seq
MIRT1046388	hsa-miR-378g	CLIP-seq
MIRT1046389	hsa-miR-3973	CLIP-seq
MIRT1046390	hsa-miR-4314	CLIP-seq
MIRT1046391	hsa-miR-4437	CLIP-seq
MIRT1046392	hsa-miR-4475	CLIP-seq
MIRT1046393	hsa-miR-4486	CLIP-seq
MIRT1046394	hsa-miR-4762-5p	CLIP-seq
MIRT1046395	hsa-miR-495	CLIP-seq
MIRT1046396	hsa-miR-519a	CLIP-seq
MIRT1046397	hsa-miR-519b-3p	CLIP-seq
MIRT1046398	hsa-miR-519c-3p	CLIP-seq
MIRT1046399	hsa-miR-519d	CLIP-seq
MIRT1046400	hsa-miR-520g	CLIP-seq
MIRT1046401	hsa-miR-520h	CLIP-seq
MIRT1046402	hsa-miR-607	CLIP-seq
MIRT1046403	hsa-miR-612	CLIP-seq
MIRT1046404	hsa-miR-629	CLIP-seq
MIRT1046405	hsa-miR-93	CLIP-seq
MIRT1046375	hsa-miR-106a	CLIP-seq
MIRT1046376	hsa-miR-106b	CLIP-seq
MIRT2010491	hsa-miR-1207-3p	CLIP-seq
MIRT2010492	hsa-miR-1207-5p	CLIP-seq
MIRT2010493	hsa-miR-1224-3p	CLIP-seq
MIRT2010494	hsa-miR-1225-3p	CLIP-seq
MIRT2010495	hsa-miR-1251	CLIP-seq
MIRT2010496	hsa-miR-1260	CLIP-seq
MIRT2010497	hsa-miR-1260b	CLIP-seq
MIRT2010498	hsa-miR-1280	CLIP-seq
MIRT2010499	hsa-miR-1289	CLIP-seq
MIRT2010500	hsa-miR-1304	CLIP-seq
MIRT1046379	hsa-miR-137	CLIP-seq
MIRT1046380	hsa-miR-17	CLIP-seq
MIRT2010501	hsa-miR-198	CLIP-seq
MIRT1046381	hsa-miR-20a	CLIP-seq
MIRT1046382	hsa-miR-20b	CLIP-seq
MIRT2010502	hsa-miR-219-1-3p	CLIP-seq
MIRT2010503	hsa-miR-24	CLIP-seq
MIRT2010504	hsa-miR-2467-5p	CLIP-seq
MIRT2010505	hsa-miR-3158-3p	CLIP-seq
MIRT2010506	hsa-miR-3188	CLIP-seq
MIRT2010507	hsa-miR-342-5p	CLIP-seq
MIRT2010508	hsa-miR-3616-3p	CLIP-seq
MIRT2010509	hsa-miR-3622b-5p	CLIP-seq
MIRT2010510	hsa-miR-3669	CLIP-seq
MIRT2010511	hsa-miR-3680	CLIP-seq
MIRT2010512	hsa-miR-3688-3p	CLIP-seq
MIRT2010513	hsa-miR-3714	CLIP-seq
MIRT1046389	hsa-miR-3973	CLIP-seq
MIRT2010514	hsa-miR-3975	CLIP-seq
MIRT2010515	hsa-miR-4253	CLIP-seq
MIRT2010516	hsa-miR-4267	CLIP-seq
MIRT2010517	hsa-miR-4270	CLIP-seq
MIRT2010518	hsa-miR-4281	CLIP-seq
MIRT2010519	hsa-miR-4323	CLIP-seq
MIRT2010520	hsa-miR-4433	CLIP-seq
MIRT2010521	hsa-miR-4441	CLIP-seq
MIRT2010522	hsa-miR-4446-3p	CLIP-seq
MIRT2010523	hsa-miR-4447	CLIP-seq
MIRT2010524	hsa-miR-4459	CLIP-seq
MIRT2010525	hsa-miR-4472	CLIP-seq
MIRT2010526	hsa-miR-4492	CLIP-seq
MIRT2010527	hsa-miR-4498	CLIP-seq
MIRT2010528	hsa-miR-4505	CLIP-seq
MIRT2010529	hsa-miR-4509	CLIP-seq
MIRT2010530	hsa-miR-4651	CLIP-seq
MIRT2010531	hsa-miR-4664-5p	CLIP-seq
MIRT2010532	hsa-miR-4667-3p	CLIP-seq
MIRT2010533	hsa-miR-4709-3p	CLIP-seq
MIRT2010534	hsa-miR-4721	CLIP-seq
MIRT2010535	hsa-miR-4722-5p	CLIP-seq
MIRT2010536	hsa-miR-4723-5p	CLIP-seq
MIRT2010537	hsa-miR-4731-5p	CLIP-seq
MIRT2010538	hsa-miR-4761-3p	CLIP-seq
MIRT2010539	hsa-miR-4762-3p	CLIP-seq
MIRT2010540	hsa-miR-4763-3p	CLIP-seq
MIRT2010541	hsa-miR-4768-3p	CLIP-seq
MIRT2010542	hsa-miR-4779	CLIP-seq
MIRT2010543	hsa-miR-485-5p	CLIP-seq
MIRT2010544	hsa-miR-488	CLIP-seq
MIRT1046396	hsa-miR-519a	CLIP-seq
MIRT1046397	hsa-miR-519b-3p	CLIP-seq
MIRT1046398	hsa-miR-519c-3p	CLIP-seq
MIRT1046399	hsa-miR-519d	CLIP-seq
MIRT1046400	hsa-miR-520g	CLIP-seq
MIRT1046401	hsa-miR-520h	CLIP-seq
MIRT2010545	hsa-miR-608	CLIP-seq
MIRT2010546	hsa-miR-762	CLIP-seq
MIRT2010547	hsa-miR-885-3p	CLIP-seq
MIRT1046405	hsa-miR-93	CLIP-seq
MIRT2010548	hsa-miR-939	CLIP-seq
MIRT2010549	hsa-miR-940	CLIP-seq
MIRT1046375	hsa-miR-106a	CLIP-seq
MIRT1046376	hsa-miR-106b	CLIP-seq
MIRT2242655	hsa-miR-1184	CLIP-seq
MIRT2242656	hsa-miR-1205	CLIP-seq
MIRT2242657	hsa-miR-1237	CLIP-seq
MIRT2242658	hsa-miR-1248	CLIP-seq
MIRT1046378	hsa-miR-132	CLIP-seq
MIRT1046379	hsa-miR-137	CLIP-seq
MIRT2242659	hsa-miR-138	CLIP-seq
MIRT2242660	hsa-miR-149	CLIP-seq
MIRT1046380	hsa-miR-17	CLIP-seq
MIRT1046381	hsa-miR-20a	CLIP-seq
MIRT1046382	hsa-miR-20b	CLIP-seq
MIRT1046383	hsa-miR-212	CLIP-seq
MIRT2010503	hsa-miR-24	CLIP-seq
MIRT2242661	hsa-miR-29a	CLIP-seq
MIRT2242662	hsa-miR-29b	CLIP-seq
MIRT2242663	hsa-miR-29c	CLIP-seq
MIRT1046384	hsa-miR-3065-5p	CLIP-seq
MIRT2242664	hsa-miR-3125	CLIP-seq
MIRT2242665	hsa-miR-3158-5p	CLIP-seq
MIRT2010513	hsa-miR-3714	CLIP-seq
MIRT2242666	hsa-miR-3907	CLIP-seq
MIRT2242667	hsa-miR-3916	CLIP-seq
MIRT1046389	hsa-miR-3973	CLIP-seq
MIRT2242668	hsa-miR-4284	CLIP-seq
MIRT2010520	hsa-miR-4433	CLIP-seq
MIRT2010524	hsa-miR-4459	CLIP-seq
MIRT2242669	hsa-miR-4640-5p	CLIP-seq
MIRT2242670	hsa-miR-4650-5p	CLIP-seq
MIRT2242671	hsa-miR-4689	CLIP-seq
MIRT2010533	hsa-miR-4709-3p	CLIP-seq
MIRT2242672	hsa-miR-4726-5p	CLIP-seq
MIRT2242673	hsa-miR-4747-3p	CLIP-seq
MIRT2242674	hsa-miR-4755-3p	CLIP-seq
MIRT2010539	hsa-miR-4762-3p	CLIP-seq
MIRT2010541	hsa-miR-4768-3p	CLIP-seq
MIRT1046395	hsa-miR-495	CLIP-seq
MIRT1046396	hsa-miR-519a	CLIP-seq
MIRT1046397	hsa-miR-519b-3p	CLIP-seq
MIRT1046398	hsa-miR-519c-3p	CLIP-seq
MIRT1046399	hsa-miR-519d	CLIP-seq
MIRT1046400	hsa-miR-520g	CLIP-seq
MIRT1046401	hsa-miR-520h	CLIP-seq
MIRT2242675	hsa-miR-524-3p	CLIP-seq
MIRT2242676	hsa-miR-525-3p	CLIP-seq
MIRT2242677	hsa-miR-544	CLIP-seq
MIRT2242678	hsa-miR-544b	CLIP-seq
MIRT2242679	hsa-miR-548q	CLIP-seq
MIRT2242680	hsa-miR-577	CLIP-seq
MIRT1046405	hsa-miR-93	CLIP-seq
MIRT2242656	hsa-miR-1205	CLIP-seq
MIRT2010503	hsa-miR-24	CLIP-seq
MIRT2242661	hsa-miR-29a	CLIP-seq
MIRT2242662	hsa-miR-29b	CLIP-seq
MIRT2242663	hsa-miR-29c	CLIP-seq
MIRT2388998	hsa-miR-3136-3p	CLIP-seq
MIRT2388999	hsa-miR-4717-3p	CLIP-seq
MIRT2242680	hsa-miR-577	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXP1	Unknown	23884370

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	11889126, 19255499, 32296183
GO:0005543	Function	Phospholipid binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	14732715
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	14732715
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006897	Process	Endocytosis	IBA
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IMP	11889126
GO:0007015	Process	Actin filament organization	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0014069	Component	Postsynaptic density	ISS	12650982
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030100	Process	Regulation of endocytosis	IMP	14742709
GO:0030100	Process	Regulation of endocytosis	NAS	20074057
GO:0030136	Component	Clathrin-coated vesicle	IBA
GO:0030136	Component	Clathrin-coated vesicle	IDA	11889126, 14732715
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030276	Function	Clathrin binding	IDA	14732715
GO:0030276	Function	Clathrin binding	IEA
GO:0030665	Component	Clathrin-coated vesicle membrane	IEA
GO:0030837	Process	Negative regulation of actin filament polymerization	IEA
GO:0030837	Process	Negative regulation of actin filament polymerization	IMP	17318189
GO:0030864	Component	Cortical actin cytoskeleton	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032051	Function	Clathrin light chain binding	IBA
GO:0032051	Function	Clathrin light chain binding	IEA
GO:0032587	Component	Ruffle membrane	IDA	14732715
GO:0032839	Component	Dendrite cytoplasm	ISS	12650982
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	14742709
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	IEA
GO:0035091	Function	Phosphatidylinositol binding	IDA	14732715
GO:0035615	Function	Clathrin adaptor activity	IBA
GO:0035615	Function	Clathrin adaptor activity	IEA
GO:0042802	Function	Identical protein binding	IPI	16415883
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	16415883
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043025	Component	Neuronal cell body	ISS	12650982
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043197	Component	Dendritic spine	ISS	12650982
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IBA
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	14732715
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IBA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	14732715
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048268	Process	Clathrin coat assembly	IBA
GO:0048268	Process	Clathrin coat assembly	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050821	Process	Protein stabilization	IDA	14732715
GO:0050821	Process	Protein stabilization	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	16415883
GO:0051015	Function	Actin filament binding	IEA
GO:0051050	Process	Positive regulation of transport	IEA
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0055123	Process	Digestive system development	IEA
GO:0060453	Process	Regulation of gastric acid secretion	IEA
GO:0061024	Process	Membrane organization	IEA
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IBA
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IDA	14732715
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IEA
GO:0097060	Component	Synaptic membrane	ISS	12650982
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IGI	19255499
GO:0098794	Component	Postsynapse	IEA
GO:0098843	Component	Postsynaptic endocytic zone	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099173	Process	Postsynapse organization	IEA
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IGI	19255499
GO:1905445	Process	Positive regulation of clathrin coat assembly	IEA
GO:2000369	Process	Regulation of clathrin-dependent endocytosis	NAS	17318189
GO:2000588	Process	Positive regulation of platelet-derived growth factor receptor-beta signaling pathway	IBA
GO:2000588	Process	Positive regulation of platelet-derived growth factor receptor-beta signaling pathway	IEA
GO:2000588	Process	Positive regulation of platelet-derived growth factor receptor-beta signaling pathway	IMP	14732715

Other IDs

• MIM: 605613
• HGNC: 18415
• e!Ensembl: ENSG00000130787

Protein

• UniProt ID: O75146
• Protein name: Huntingtin-interacting protein 1-related protein (HIP1-related protein) (Huntingtin-interacting protein 12) (HIP-12)
• Protein function: Component of clathrin-coated pits and vesicles, that may link the endocytic machinery to the actin cytoskeleton. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosi
• PDB: 1R0D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07651	ANTH	30 → 299	ANTH domain	Domain
  PF16515	HIP1_clath_bdg	461 → 559	Clathrin-binding domain of Huntingtin-interacting protein 1	Coiled-coil
  PF01608	I_LWEQ	862 → 1010	I/LWEQ domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Brain, heart, kidney, pancreas, and liver, but not in lung or placenta.
• Sequence:

  MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHH
  EKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWG
  HLHDRYGQLVNVYTKLLLTKISFHLKHPQFPAGLEVTDEVLEKAAGTDVNNIFQLTVEMF
  DYMDCELKLSESVFRQLNTAIAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLLFKLHSC
  LPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHIK
  PVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFGPPNGSVKDDRDLQIESLK
  REVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLR
  AAQLEGERSQGLREEAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQQ
  SQEEVARVKEQLAFQVEQVKRESELKLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQ
  SKSELSSRLDTLSAEKDALSGAVRQREADLLAAQSLVRETEAALSREQQRSSQEQGELQG
  RLAERESQEQGLRQRLLDEQFAVLRGAAAEAAGILQDAVSKLDDPLHLRCTSSPDYLVSR
  AQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAADTIINGGATSHLAPTDPADR
  LIDTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELKPKSLDVRQEELG
  AVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTT
  STSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKY
  EELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQI
  EDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGE
  EVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLVNY

• Sequence length: 1068

Pathways

Reactome:

Golgi Associated Vesicle Biogenesis
Clathrin-mediated endocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23884370		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	35511748	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	15588756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15588756, 17239488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	36811277	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19453646		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23884370, 27224915		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	21734494		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35511748	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	15588756		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	15588756		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	15588756		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	15588756		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	15588756		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	15588756		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	15588756		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26898757		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	35511748	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36811277	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21812969, 22786590	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	GWASDB_DG	22438815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	24312176, 24631562, 25818163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	24312176	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26898757		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	30285260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	32548851, 36811277	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35209947	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34541834	Associate	★☆☆☆☆ Found in Text Mining only