RNF8 (ring finger protein 8)

Gene

• Entrez ID: 9025
• Gene name: Ring finger protein 8
• Gene symbol: RNF8
• Synonyms (NCBI Gene): hRNF8
• Chromosome: 6
• Chromosome location: 6p21.2
• Summary: The protein encoded by this gene contains a RING finger motif and an FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin liga

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT717307	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT717306	hsa-miR-4744	HITS-CLIP	19536157
MIRT717305	hsa-miR-4509	HITS-CLIP	19536157
MIRT717304	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT717303	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT717301	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT717302	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT717300	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT717299	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT717298	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT317777	hsa-miR-4310	HITS-CLIP	23824327
MIRT317781	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT632490	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT632489	hsa-miR-877-5p	HITS-CLIP	23824327
MIRT632488	hsa-miR-6866-5p	HITS-CLIP	23824327
MIRT632487	hsa-miR-7977	HITS-CLIP	23824327
MIRT632486	hsa-miR-1303	HITS-CLIP	23824327
MIRT737211	hsa-miR-622	Western blotting, qRT-PCR	31709182
MIRT717307	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT717306	hsa-miR-4744	HITS-CLIP	19536157
MIRT717305	hsa-miR-4509	HITS-CLIP	19536157
MIRT717304	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT717303	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT717301	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT717302	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT717300	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT717299	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT717298	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT317777	hsa-miR-4310	HITS-CLIP	23824327
MIRT317781	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT632490	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT632489	hsa-miR-877-5p	HITS-CLIP	23824327
MIRT632488	hsa-miR-6866-5p	HITS-CLIP	23824327
MIRT632487	hsa-miR-7977	HITS-CLIP	23824327
MIRT632486	hsa-miR-1303	HITS-CLIP	23824327
MIRT755736	hsa-miR-654-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35742854
MIRT1313727	hsa-miR-1184	CLIP-seq
MIRT1313728	hsa-miR-1205	CLIP-seq
MIRT1313729	hsa-miR-1224-3p	CLIP-seq
MIRT1313730	hsa-miR-1245b-3p	CLIP-seq
MIRT1313731	hsa-miR-1267	CLIP-seq
MIRT1313732	hsa-miR-1270	CLIP-seq
MIRT1313733	hsa-miR-1299	CLIP-seq
MIRT1313734	hsa-miR-1301	CLIP-seq
MIRT1313735	hsa-miR-1323	CLIP-seq
MIRT1313736	hsa-miR-135a	CLIP-seq
MIRT1313737	hsa-miR-135b	CLIP-seq
MIRT1313738	hsa-miR-146a	CLIP-seq
MIRT1313739	hsa-miR-146b-5p	CLIP-seq
MIRT1313740	hsa-miR-2392	CLIP-seq
MIRT1313741	hsa-miR-2682	CLIP-seq
MIRT1313742	hsa-miR-3064-3p	CLIP-seq
MIRT1313743	hsa-miR-3065-5p	CLIP-seq
MIRT1313744	hsa-miR-30a	CLIP-seq
MIRT1313745	hsa-miR-30b	CLIP-seq
MIRT1313746	hsa-miR-30c	CLIP-seq
MIRT1313747	hsa-miR-30d	CLIP-seq
MIRT1313748	hsa-miR-30e	CLIP-seq
MIRT1313749	hsa-miR-3135	CLIP-seq
MIRT1313750	hsa-miR-3158-5p	CLIP-seq
MIRT1313751	hsa-miR-3159	CLIP-seq
MIRT1313752	hsa-miR-3163	CLIP-seq
MIRT1313753	hsa-miR-3165	CLIP-seq
MIRT1313754	hsa-miR-3173-3p	CLIP-seq
MIRT1313755	hsa-miR-3174	CLIP-seq
MIRT1313756	hsa-miR-3180-5p	CLIP-seq
MIRT1313757	hsa-miR-3184	CLIP-seq
MIRT1313758	hsa-miR-3192	CLIP-seq
MIRT1313759	hsa-miR-342-3p	CLIP-seq
MIRT1313760	hsa-miR-34b	CLIP-seq
MIRT1313761	hsa-miR-3605-5p	CLIP-seq
MIRT1313762	hsa-miR-3646	CLIP-seq
MIRT1313763	hsa-miR-3665	CLIP-seq
MIRT1313764	hsa-miR-3677-5p	CLIP-seq
MIRT1313765	hsa-miR-3688-3p	CLIP-seq
MIRT1313766	hsa-miR-3689a-3p	CLIP-seq
MIRT1313767	hsa-miR-3689c	CLIP-seq
MIRT1313768	hsa-miR-3689d	CLIP-seq
MIRT1313769	hsa-miR-377	CLIP-seq
MIRT1313770	hsa-miR-3919	CLIP-seq
MIRT1313771	hsa-miR-3925-5p	CLIP-seq
MIRT1313772	hsa-miR-423-5p	CLIP-seq
MIRT1313773	hsa-miR-4267	CLIP-seq
MIRT1313774	hsa-miR-4284	CLIP-seq
MIRT1313775	hsa-miR-4314	CLIP-seq
MIRT1313776	hsa-miR-4423-5p	CLIP-seq
MIRT1313777	hsa-miR-4433	CLIP-seq
MIRT1313778	hsa-miR-4434	CLIP-seq
MIRT1313779	hsa-miR-4459	CLIP-seq
MIRT1313780	hsa-miR-449c	CLIP-seq
MIRT1313781	hsa-miR-4516	CLIP-seq
MIRT1313782	hsa-miR-4521	CLIP-seq
MIRT1313783	hsa-miR-4531	CLIP-seq
MIRT1313784	hsa-miR-4536	CLIP-seq
MIRT1313785	hsa-miR-4637	CLIP-seq
MIRT1313786	hsa-miR-4639-3p	CLIP-seq
MIRT1313787	hsa-miR-4646-5p	CLIP-seq
MIRT1313788	hsa-miR-4660	CLIP-seq
MIRT1313789	hsa-miR-4715-3p	CLIP-seq
MIRT1313790	hsa-miR-4716-3p	CLIP-seq
MIRT1313791	hsa-miR-4728-5p	CLIP-seq
MIRT1313792	hsa-miR-4736	CLIP-seq
MIRT1313793	hsa-miR-4761-5p	CLIP-seq
MIRT1313794	hsa-miR-4766-5p	CLIP-seq
MIRT1313795	hsa-miR-4768-3p	CLIP-seq
MIRT1313796	hsa-miR-4779	CLIP-seq
MIRT1313797	hsa-miR-4797-5p	CLIP-seq
MIRT1313798	hsa-miR-4802-3p	CLIP-seq
MIRT1313799	hsa-miR-483-3p	CLIP-seq
MIRT1313800	hsa-miR-488	CLIP-seq
MIRT1313801	hsa-miR-5047	CLIP-seq
MIRT1313802	hsa-miR-520a-5p	CLIP-seq
MIRT1313803	hsa-miR-525-5p	CLIP-seq
MIRT1313804	hsa-miR-548ag	CLIP-seq
MIRT1313805	hsa-miR-548ai	CLIP-seq
MIRT1313806	hsa-miR-548o	CLIP-seq
MIRT1313807	hsa-miR-620	CLIP-seq
MIRT1313808	hsa-miR-624	CLIP-seq
MIRT1313809	hsa-miR-625	CLIP-seq
MIRT1313810	hsa-miR-627	CLIP-seq
MIRT1313811	hsa-miR-635	CLIP-seq
MIRT1313812	hsa-miR-760	CLIP-seq
MIRT1313813	hsa-miR-802	CLIP-seq
MIRT1313814	hsa-miR-875-3p	CLIP-seq
MIRT1313815	hsa-miR-877	CLIP-seq
MIRT1313816	hsa-miR-921	CLIP-seq
MIRT1313817	hsa-miR-924	CLIP-seq
MIRT1313818	hsa-miR-935	CLIP-seq
MIRT1313819	hsa-miR-940	CLIP-seq
MIRT1313820	hsa-miR-1268	CLIP-seq
MIRT1313821	hsa-miR-1268b	CLIP-seq
MIRT1313822	hsa-miR-128	CLIP-seq
MIRT1313823	hsa-miR-144	CLIP-seq
MIRT1313824	hsa-miR-15a	CLIP-seq
MIRT1313825	hsa-miR-15b	CLIP-seq
MIRT1313826	hsa-miR-16	CLIP-seq
MIRT1313827	hsa-miR-195	CLIP-seq
MIRT1313828	hsa-miR-2117	CLIP-seq
MIRT1313829	hsa-miR-24	CLIP-seq
MIRT1313830	hsa-miR-25	CLIP-seq
MIRT1313831	hsa-miR-27a	CLIP-seq
MIRT1313832	hsa-miR-27b	CLIP-seq
MIRT1313833	hsa-miR-3064-5p	CLIP-seq
MIRT1313834	hsa-miR-3148	CLIP-seq
MIRT1313835	hsa-miR-3160-3p	CLIP-seq
MIRT1313756	hsa-miR-3180-5p	CLIP-seq
MIRT1313836	hsa-miR-3189-5p	CLIP-seq
MIRT1313837	hsa-miR-32	CLIP-seq
MIRT1313838	hsa-miR-363	CLIP-seq
MIRT1313839	hsa-miR-367	CLIP-seq
MIRT1313840	hsa-miR-3672	CLIP-seq
MIRT1313766	hsa-miR-3689a-3p	CLIP-seq
MIRT1313767	hsa-miR-3689c	CLIP-seq
MIRT1313768	hsa-miR-3689d	CLIP-seq
MIRT1313841	hsa-miR-374c	CLIP-seq
MIRT1313842	hsa-miR-375	CLIP-seq
MIRT1313843	hsa-miR-3922-5p	CLIP-seq
MIRT1313844	hsa-miR-3926	CLIP-seq
MIRT1313845	hsa-miR-3929	CLIP-seq
MIRT1313846	hsa-miR-3974	CLIP-seq
MIRT1313847	hsa-miR-3977	CLIP-seq
MIRT1313848	hsa-miR-421	CLIP-seq
MIRT1313849	hsa-miR-424	CLIP-seq
MIRT1313850	hsa-miR-4272	CLIP-seq
MIRT1313851	hsa-miR-4273	CLIP-seq
MIRT1313852	hsa-miR-4279	CLIP-seq
MIRT1313774	hsa-miR-4284	CLIP-seq
MIRT1313853	hsa-miR-4325	CLIP-seq
MIRT1313854	hsa-miR-4419b	CLIP-seq
MIRT1313855	hsa-miR-4422	CLIP-seq
MIRT1313777	hsa-miR-4433	CLIP-seq
MIRT1313779	hsa-miR-4459	CLIP-seq
MIRT1313856	hsa-miR-4478	CLIP-seq
MIRT1313857	hsa-miR-4486	CLIP-seq
MIRT1313858	hsa-miR-4487	CLIP-seq
MIRT1313859	hsa-miR-4505	CLIP-seq
MIRT1313860	hsa-miR-4528	CLIP-seq
MIRT1313861	hsa-miR-4677-5p	CLIP-seq
MIRT1313862	hsa-miR-4684-5p	CLIP-seq
MIRT1313791	hsa-miR-4728-5p	CLIP-seq
MIRT1313863	hsa-miR-4733-5p	CLIP-seq
MIRT1313795	hsa-miR-4768-3p	CLIP-seq
MIRT1313864	hsa-miR-4786-5p	CLIP-seq
MIRT1313799	hsa-miR-483-3p	CLIP-seq
MIRT1313865	hsa-miR-497	CLIP-seq
MIRT1313866	hsa-miR-513a-5p	CLIP-seq
MIRT1313802	hsa-miR-520a-5p	CLIP-seq
MIRT1313803	hsa-miR-525-5p	CLIP-seq
MIRT1313867	hsa-miR-548n	CLIP-seq
MIRT1313868	hsa-miR-548s	CLIP-seq
MIRT1313869	hsa-miR-558	CLIP-seq
MIRT1313870	hsa-miR-585	CLIP-seq
MIRT1313871	hsa-miR-604	CLIP-seq
MIRT1313872	hsa-miR-647	CLIP-seq
MIRT1313873	hsa-miR-655	CLIP-seq
MIRT1313874	hsa-miR-668	CLIP-seq
MIRT1313875	hsa-miR-769-5p	CLIP-seq
MIRT1313876	hsa-miR-873	CLIP-seq
MIRT1313877	hsa-miR-92a	CLIP-seq
MIRT1313878	hsa-miR-92b	CLIP-seq
MIRT1313836	hsa-miR-3189-5p	CLIP-seq
MIRT1313843	hsa-miR-3922-5p	CLIP-seq
MIRT1313808	hsa-miR-624	CLIP-seq
MIRT1313831	hsa-miR-27a	CLIP-seq
MIRT1313832	hsa-miR-27b	CLIP-seq
MIRT2093388	hsa-miR-3613-3p	CLIP-seq
MIRT1313799	hsa-miR-483-3p	CLIP-seq
MIRT1313866	hsa-miR-513a-5p	CLIP-seq
MIRT2093389	hsa-miR-593	CLIP-seq
MIRT2093390	hsa-miR-657	CLIP-seq
MIRT2093391	hsa-miR-1252	CLIP-seq
MIRT2093392	hsa-miR-4747-5p	CLIP-seq
MIRT2093391	hsa-miR-1252	CLIP-seq
MIRT2317920	hsa-miR-2114	CLIP-seq
MIRT2317921	hsa-miR-216a	CLIP-seq
MIRT2317922	hsa-miR-216b	CLIP-seq
MIRT1313829	hsa-miR-24	CLIP-seq
MIRT1313831	hsa-miR-27a	CLIP-seq
MIRT1313832	hsa-miR-27b	CLIP-seq
MIRT2317923	hsa-miR-3065-3p	CLIP-seq
MIRT2317924	hsa-miR-3122	CLIP-seq
MIRT1313836	hsa-miR-3189-5p	CLIP-seq
MIRT1313758	hsa-miR-3192	CLIP-seq
MIRT2317925	hsa-miR-3660	CLIP-seq
MIRT1313766	hsa-miR-3689a-3p	CLIP-seq
MIRT1313767	hsa-miR-3689c	CLIP-seq
MIRT1313768	hsa-miR-3689d	CLIP-seq
MIRT2317926	hsa-miR-3913-5p	CLIP-seq
MIRT1313843	hsa-miR-3922-5p	CLIP-seq
MIRT1313773	hsa-miR-4267	CLIP-seq
MIRT1313774	hsa-miR-4284	CLIP-seq
MIRT2317927	hsa-miR-4293	CLIP-seq
MIRT1313775	hsa-miR-4314	CLIP-seq
MIRT2317928	hsa-miR-4514	CLIP-seq
MIRT2317929	hsa-miR-4526	CLIP-seq
MIRT2317930	hsa-miR-4633-5p	CLIP-seq
MIRT1313787	hsa-miR-4646-5p	CLIP-seq
MIRT2317931	hsa-miR-4663	CLIP-seq
MIRT2317932	hsa-miR-4692	CLIP-seq
MIRT2317933	hsa-miR-4701-5p	CLIP-seq
MIRT1313791	hsa-miR-4728-5p	CLIP-seq
MIRT1313793	hsa-miR-4761-5p	CLIP-seq
MIRT2317934	hsa-miR-4796-3p	CLIP-seq
MIRT1313797	hsa-miR-4797-5p	CLIP-seq
MIRT1313866	hsa-miR-513a-5p	CLIP-seq
MIRT2317935	hsa-miR-532-5p	CLIP-seq
MIRT2317936	hsa-miR-588	CLIP-seq
MIRT1313810	hsa-miR-627	CLIP-seq
MIRT2317937	hsa-miR-890	CLIP-seq
MIRT1313817	hsa-miR-924	CLIP-seq
MIRT2317920	hsa-miR-2114	CLIP-seq
MIRT1313829	hsa-miR-24	CLIP-seq
MIRT1313836	hsa-miR-3189-5p	CLIP-seq
MIRT1313766	hsa-miR-3689a-3p	CLIP-seq
MIRT1313767	hsa-miR-3689c	CLIP-seq
MIRT1313843	hsa-miR-3922-5p	CLIP-seq
MIRT1313774	hsa-miR-4284	CLIP-seq
MIRT2317930	hsa-miR-4633-5p	CLIP-seq
MIRT1313791	hsa-miR-4728-5p	CLIP-seq
MIRT2317935	hsa-miR-532-5p	CLIP-seq
MIRT2317937	hsa-miR-890	CLIP-seq
MIRT2439964	hsa-miR-3127-5p	CLIP-seq
MIRT2439965	hsa-miR-383	CLIP-seq
MIRT2439966	hsa-miR-3918	CLIP-seq
MIRT2439967	hsa-miR-4772-5p	CLIP-seq
MIRT2458477	hsa-miR-1183	CLIP-seq
MIRT2458478	hsa-miR-3145-5p	CLIP-seq
MIRT2458479	hsa-miR-320a	CLIP-seq
MIRT2458480	hsa-miR-320b	CLIP-seq
MIRT2458481	hsa-miR-320c	CLIP-seq
MIRT2458482	hsa-miR-320d	CLIP-seq
MIRT1313773	hsa-miR-4267	CLIP-seq
MIRT2458483	hsa-miR-4330	CLIP-seq
MIRT2458484	hsa-miR-4429	CLIP-seq
MIRT1313778	hsa-miR-4434	CLIP-seq
MIRT2458485	hsa-miR-4453	CLIP-seq
MIRT1313781	hsa-miR-4516	CLIP-seq
MIRT2458486	hsa-miR-451b	CLIP-seq
MIRT2458487	hsa-miR-4538	CLIP-seq
MIRT2458488	hsa-miR-4742-3p	CLIP-seq
MIRT2458489	hsa-miR-508-5p	CLIP-seq
MIRT1313811	hsa-miR-635	CLIP-seq
MIRT2458490	hsa-miR-766	CLIP-seq
MIRT2613599	hsa-miR-10a	CLIP-seq
MIRT2613600	hsa-miR-10b	CLIP-seq
MIRT2458477	hsa-miR-1183	CLIP-seq
MIRT2613601	hsa-miR-1298	CLIP-seq
MIRT1313735	hsa-miR-1323	CLIP-seq
MIRT2613602	hsa-miR-139-5p	CLIP-seq
MIRT2613603	hsa-miR-142-3p	CLIP-seq
MIRT1313738	hsa-miR-146a	CLIP-seq
MIRT1313739	hsa-miR-146b-5p	CLIP-seq
MIRT2613604	hsa-miR-202	CLIP-seq
MIRT2317921	hsa-miR-216a	CLIP-seq
MIRT2317922	hsa-miR-216b	CLIP-seq
MIRT2613605	hsa-miR-297	CLIP-seq
MIRT2317923	hsa-miR-3065-3p	CLIP-seq
MIRT1313743	hsa-miR-3065-5p	CLIP-seq
MIRT2317924	hsa-miR-3122	CLIP-seq
MIRT2458478	hsa-miR-3145-5p	CLIP-seq
MIRT2613606	hsa-miR-3158-3p	CLIP-seq
MIRT1313755	hsa-miR-3174	CLIP-seq
MIRT2613607	hsa-miR-339-5p	CLIP-seq
MIRT2613608	hsa-miR-3616-3p	CLIP-seq
MIRT2613609	hsa-miR-3662	CLIP-seq
MIRT2613610	hsa-miR-3671	CLIP-seq
MIRT1313766	hsa-miR-3689a-3p	CLIP-seq
MIRT1313767	hsa-miR-3689c	CLIP-seq
MIRT1313768	hsa-miR-3689d	CLIP-seq
MIRT2317926	hsa-miR-3913-5p	CLIP-seq
MIRT1313771	hsa-miR-3925-5p	CLIP-seq
MIRT1313773	hsa-miR-4267	CLIP-seq
MIRT2613611	hsa-miR-4421	CLIP-seq
MIRT2458485	hsa-miR-4453	CLIP-seq
MIRT1313784	hsa-miR-4536	CLIP-seq
MIRT2458487	hsa-miR-4538	CLIP-seq
MIRT1313862	hsa-miR-4684-5p	CLIP-seq
MIRT2613612	hsa-miR-4721	CLIP-seq
MIRT1313791	hsa-miR-4728-5p	CLIP-seq
MIRT1313793	hsa-miR-4761-5p	CLIP-seq
MIRT2613613	hsa-miR-505	CLIP-seq
MIRT2458489	hsa-miR-508-5p	CLIP-seq
MIRT2613614	hsa-miR-516a-3p	CLIP-seq
MIRT2613615	hsa-miR-548c-3p	CLIP-seq
MIRT1313806	hsa-miR-548o	CLIP-seq
MIRT2613616	hsa-miR-567	CLIP-seq
MIRT2093389	hsa-miR-593	CLIP-seq
MIRT2613617	hsa-miR-618	CLIP-seq
MIRT1313811	hsa-miR-635	CLIP-seq
MIRT2613618	hsa-miR-654-3p	CLIP-seq
MIRT2458490	hsa-miR-766	CLIP-seq
MIRT1313813	hsa-miR-802	CLIP-seq
MIRT2613619	hsa-miR-888	CLIP-seq
MIRT1313816	hsa-miR-921	CLIP-seq
MIRT2613620	hsa-miR-95	CLIP-seq
MIRT2613599	hsa-miR-10a	CLIP-seq
MIRT2613600	hsa-miR-10b	CLIP-seq
MIRT2613602	hsa-miR-139-5p	CLIP-seq
MIRT2317921	hsa-miR-216a	CLIP-seq
MIRT2317922	hsa-miR-216b	CLIP-seq
MIRT2317923	hsa-miR-3065-3p	CLIP-seq
MIRT2317924	hsa-miR-3122	CLIP-seq
MIRT2613606	hsa-miR-3158-3p	CLIP-seq
MIRT2613607	hsa-miR-339-5p	CLIP-seq
MIRT2613608	hsa-miR-3616-3p	CLIP-seq
MIRT1313766	hsa-miR-3689a-3p	CLIP-seq
MIRT1313767	hsa-miR-3689c	CLIP-seq
MIRT2317926	hsa-miR-3913-5p	CLIP-seq
MIRT2613611	hsa-miR-4421	CLIP-seq
MIRT1313784	hsa-miR-4536	CLIP-seq
MIRT1313862	hsa-miR-4684-5p	CLIP-seq
MIRT2613612	hsa-miR-4721	CLIP-seq
MIRT1313791	hsa-miR-4728-5p	CLIP-seq
MIRT1313793	hsa-miR-4761-5p	CLIP-seq
MIRT2613614	hsa-miR-516a-3p	CLIP-seq
MIRT2093389	hsa-miR-593	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CHD4	Unknown	22531782

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA
GO:0000151	Component	Ubiquitin ligase complex	IDA	18001824, 18001825
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000781	Component	Chromosome, telomeric region	ISS
GO:0003682	Function	Chromatin binding	IDA	18001824, 18001825
GO:0003682	Function	Chromatin binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 18001824, 18001825, 19690564, 20023648, 21516116, 22266820, 22373579, 22508508, 24240613, 25416956, 25512560, 26869104, 27715493, 31515488, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18001824, 18001825
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006302	Process	Double-strand break repair	IBA
GO:0006302	Process	Double-strand break repair	IDA	18001824, 18001825, 22980979
GO:0006302	Process	Double-strand break repair	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	ISS
GO:0006325	Process	Chromatin organization	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	22266820, 22373579
GO:0006974	Process	DNA damage response	IDA	20550933, 21911360, 22266820, 22373579, 22980979
GO:0006974	Process	DNA damage response	IEA
GO:0008270	Function	Zinc ion binding	IDA	22980979
GO:0008270	Function	Zinc ion binding	IEA
GO:0010212	Process	Response to ionizing radiation	IDA	18001824, 18001825
GO:0010212	Process	Response to ionizing radiation	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030496	Component	Midbody	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22266820
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IMP	20550933
GO:0035092	Process	Sperm DNA condensation	IEA
GO:0035092	Process	Sperm DNA condensation	ISS
GO:0035861	Component	Site of double-strand break	IBA
GO:0035861	Component	Site of double-strand break	IDA	22266820
GO:0036297	Process	Interstrand cross-link repair	TAS	22705371
GO:0040029	Process	Epigenetic regulation of gene expression	IMP	20550933
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	18001824, 18001825
GO:0042393	Function	Histone binding	IEA
GO:0042770	Process	Signal transduction in response to DNA damage	IEA
GO:0042802	Function	Identical protein binding	IPI	22980979, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	22980979
GO:0043130	Function	Ubiquitin binding	IEA
GO:0045190	Process	Isotype switching	IEA
GO:0045190	Process	Isotype switching	ISS
GO:0045739	Process	Positive regulation of DNA repair	IDA	18001824, 18001825
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0051865	Process	Protein autoubiquitination	IDA	22266820
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	18001824, 18001825, 18948756, 21911360, 22266820, 22373579, 22980979, 23115235
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	21911360
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	21911360, 22266820, 22373579
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	23115235
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	18001824, 18001825, 22980979
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	23115235
GO:1990166	Process	Protein localization to site of double-strand break	IDA	18411307, 18583988

Other IDs

• MIM: 611685
• HGNC: 10071
• e!Ensembl: ENSG00000112130

Protein

• UniProt ID: O76064
• Protein name: E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8)
• Protein function: E3 ubiquitin-protein ligase that plays a key role in DNA damage signaling via 2 distinct roles: by mediating the 'Lys-63'-linked ubiquitination of histones H2A and H2AX and promoting the recruitment of DNA repair proteins at double-strand breaks
• PDB: 2CSW, 2PIE, 4AYC, 4ORH, 4WHV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00498	FHA	38 → 109	FHA domain	Family
  PF13920	zf-C3HC4_3	399 → 447		Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. In fetal tissues, highest expression in brain, thymus and liver. In adult tissues, highest levels in brain and testis, lowest levels in peripheral blood cells. {ECO:0000269|PubMed:16215985, ECO:0000269|PubMed:9852682}.
• Sequence:

  MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMIS
  RNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEY
  EYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVS
  CESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSS
  ASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLC
  AEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKD
  FEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAH
  SFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERK
  AKRLF

• Sequence length: 485

Pathways

Reactome:

Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Nonhomologous End-Joining (NHEJ)
Processing of DNA double-strand break ends
G2/M DNA damage checkpoint

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30992691		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29321089		★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	28398700	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	18621663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26788910		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21774837, 27618486, 27909234, 28216286, 30222135, 31709182		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24581343, 27909234, 28216286, 31294443, 32753472, 37154586	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28507061	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37154586	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26788910		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29321089		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	25483088	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23935401	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38204601	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	35428760	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	35428760	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22705371, 27277787		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22705371, 27277787		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37468549	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32753472	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21774837, 27618486, 27909234, 28216286, 30222135, 31709182		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25483088		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26788910		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27618486, 31182912, 31613024		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29321089		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27618486, 28507061, 31182912, 31294443, 31613024		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	9852682		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35831895	Associate	★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	25374327		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23578064		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25483088, 27391345	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35428760	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30848215		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24581343		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24581343, 33205415	Associate	★☆☆☆☆ Found in Text Mining only