Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9024
Gene name	BR serine/threonine kinase 2
Gene symbol	BRSK2
Synonyms (NCBI Gene)	C11orf7PEN11BSAD-ASAD1SADASTK29
Chromosome	11
Chromosome location	11p15.5

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1135402760	AG>-	Likely-pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs1554904772	G>A	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant, 5 prime UTR variant

130

Show/Hide all (130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029356	hsa-miR-26b-5p	Microarray	19088304
MIRT662463	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662462	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT662461	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT487644	hsa-miR-3141	PAR-CLIP	20371350
MIRT483135	hsa-miR-4285	PAR-CLIP	20371350
MIRT487643	hsa-miR-5090	PAR-CLIP	20371350
MIRT487642	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT487641	hsa-miR-4508	PAR-CLIP	20371350
MIRT483134	hsa-miR-1827	PAR-CLIP	20371350
MIRT487640	hsa-miR-6132	PAR-CLIP	20371350
MIRT487639	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT483133	hsa-miR-3960	PAR-CLIP	20371350
MIRT483132	hsa-miR-8072	PAR-CLIP	20371350
MIRT487638	hsa-miR-1207-5p	PAR-CLIP	20371350
MIRT487637	hsa-miR-4763-3p	PAR-CLIP	20371350
MIRT483129	hsa-miR-4467	PAR-CLIP	20371350
MIRT487636	hsa-miR-6721-5p	PAR-CLIP	20371350
MIRT487635	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT487634	hsa-miR-6727-5p	PAR-CLIP	20371350
MIRT487644	hsa-miR-3141	PAR-CLIP	23592263
MIRT483135	hsa-miR-4285	PAR-CLIP	23592263
MIRT487643	hsa-miR-5090	PAR-CLIP	23592263
MIRT487642	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT487641	hsa-miR-4508	PAR-CLIP	23592263
MIRT487640	hsa-miR-6132	PAR-CLIP	23592263
MIRT487639	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT483133	hsa-miR-3960	PAR-CLIP	23592263
MIRT483132	hsa-miR-8072	PAR-CLIP	23592263
MIRT483131	hsa-miR-4767	PAR-CLIP	23592263
MIRT487638	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT487637	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT483129	hsa-miR-4467	PAR-CLIP	23592263
MIRT487636	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT487635	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT487634	hsa-miR-6727-5p	PAR-CLIP	23592263
MIRT483135	hsa-miR-4285	PAR-CLIP	23592263
MIRT483134	hsa-miR-1827	PAR-CLIP	23592263
MIRT483133	hsa-miR-3960	PAR-CLIP	23592263
MIRT483132	hsa-miR-8072	PAR-CLIP	23592263
MIRT483131	hsa-miR-4767	PAR-CLIP	23592263
MIRT483129	hsa-miR-4467	PAR-CLIP	23592263
MIRT487638	hsa-miR-1207-5p	PAR-CLIP	27292025
MIRT487644	hsa-miR-3141	PAR-CLIP	27292025
MIRT483133	hsa-miR-3960	PAR-CLIP	27292025
MIRT483135	hsa-miR-4285	PAR-CLIP	27292025
MIRT483129	hsa-miR-4467	PAR-CLIP	27292025
MIRT487641	hsa-miR-4508	PAR-CLIP	27292025
MIRT487637	hsa-miR-4763-3p	PAR-CLIP	27292025
MIRT483131	hsa-miR-4767	PAR-CLIP	27292025
MIRT487635	hsa-miR-486-3p	PAR-CLIP	27292025
MIRT487643	hsa-miR-5090	PAR-CLIP	27292025
MIRT487640	hsa-miR-6132	PAR-CLIP	27292025
MIRT487636	hsa-miR-6721-5p	PAR-CLIP	27292025
MIRT487634	hsa-miR-6727-5p	PAR-CLIP	27292025
MIRT487642	hsa-miR-6775-5p	PAR-CLIP	27292025
MIRT487639	hsa-miR-6836-5p	PAR-CLIP	27292025
MIRT483132	hsa-miR-8072	PAR-CLIP	27292025
MIRT662463	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662462	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT662461	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT487644	hsa-miR-3141	PAR-CLIP	20371350
MIRT483135	hsa-miR-4285	PAR-CLIP	20371350
MIRT487643	hsa-miR-5090	PAR-CLIP	20371350
MIRT487642	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT487641	hsa-miR-4508	PAR-CLIP	20371350
MIRT483134	hsa-miR-1827	PAR-CLIP	20371350
MIRT487640	hsa-miR-6132	PAR-CLIP	20371350
MIRT487639	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT483133	hsa-miR-3960	PAR-CLIP	20371350
MIRT483132	hsa-miR-8072	PAR-CLIP	20371350
MIRT487638	hsa-miR-1207-5p	PAR-CLIP	20371350
MIRT487637	hsa-miR-4763-3p	PAR-CLIP	20371350
MIRT483129	hsa-miR-4467	PAR-CLIP	20371350
MIRT487636	hsa-miR-6721-5p	PAR-CLIP	20371350
MIRT487635	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT487634	hsa-miR-6727-5p	PAR-CLIP	20371350
MIRT487644	hsa-miR-3141	PAR-CLIP	23592263
MIRT483135	hsa-miR-4285	PAR-CLIP	23592263
MIRT487643	hsa-miR-5090	PAR-CLIP	23592263
MIRT487642	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT487641	hsa-miR-4508	PAR-CLIP	23592263
MIRT487640	hsa-miR-6132	PAR-CLIP	23592263
MIRT487639	hsa-miR-6836-5p	PAR-CLIP	23592263
MIRT483133	hsa-miR-3960	PAR-CLIP	23592263
MIRT483132	hsa-miR-8072	PAR-CLIP	23592263
MIRT483131	hsa-miR-4767	PAR-CLIP	23592263
MIRT487638	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT487637	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT483129	hsa-miR-4467	PAR-CLIP	23592263
MIRT487636	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT487635	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT487634	hsa-miR-6727-5p	PAR-CLIP	23592263
MIRT483135	hsa-miR-4285	PAR-CLIP	23592263
MIRT483134	hsa-miR-1827	PAR-CLIP	23592263
MIRT483133	hsa-miR-3960	PAR-CLIP	23592263
MIRT483132	hsa-miR-8072	PAR-CLIP	23592263
MIRT483131	hsa-miR-4767	PAR-CLIP	23592263
MIRT483129	hsa-miR-4467	PAR-CLIP	23592263
MIRT825497	hsa-miR-1226	CLIP-seq
MIRT825498	hsa-miR-1234	CLIP-seq
MIRT825499	hsa-miR-141	CLIP-seq
MIRT825500	hsa-miR-200a	CLIP-seq
MIRT825501	hsa-miR-3176	CLIP-seq
MIRT825502	hsa-miR-3194-5p	CLIP-seq
MIRT825503	hsa-miR-370	CLIP-seq
MIRT825504	hsa-miR-3922-3p	CLIP-seq
MIRT825505	hsa-miR-3943	CLIP-seq
MIRT825506	hsa-miR-4299	CLIP-seq
MIRT825507	hsa-miR-4456	CLIP-seq
MIRT825508	hsa-miR-4646-5p	CLIP-seq
MIRT825509	hsa-miR-4690-3p	CLIP-seq
MIRT825510	hsa-miR-4731-5p	CLIP-seq
MIRT825511	hsa-miR-4747-5p	CLIP-seq
MIRT825512	hsa-miR-4758-3p	CLIP-seq
MIRT825513	hsa-miR-548q	CLIP-seq
MIRT825514	hsa-miR-593	CLIP-seq
MIRT825515	hsa-miR-760	CLIP-seq
MIRT1944047	hsa-miR-3127-3p	CLIP-seq
MIRT1944048	hsa-miR-412	CLIP-seq
MIRT1944049	hsa-miR-4520a-3p	CLIP-seq
MIRT1944050	hsa-miR-4520b-3p	CLIP-seq
MIRT1944051	hsa-miR-4529-3p	CLIP-seq
MIRT2182628	hsa-miR-4722-5p	CLIP-seq
MIRT2384888	hsa-miR-4695-5p	CLIP-seq
MIRT1944047	hsa-miR-3127-3p	CLIP-seq
MIRT2676064	hsa-miR-3616-3p	CLIP-seq
MIRT2676065	hsa-miR-4290	CLIP-seq
MIRT2676066	hsa-miR-4667-3p	CLIP-seq
MIRT2676067	hsa-miR-4721	CLIP-seq

Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IMP	23029325
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	14976552
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14976552
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	22609399, 32296183, 36931259
GO:0005524	Function	ATP binding	IDA	14976552
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	22713462, 23907667
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	23907667
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	23029325
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IDA	14976552
GO:0006887	Process	Exocytosis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	IEA
GO:0007409	Process	Axonogenesis	ISS
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0030036	Process	Actin cytoskeleton organization	IMP	22669945
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0036503	Process	ERAD pathway	IMP	23907667
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0050321	Function	Tau-protein kinase activity	IBA
GO:0050321	Function	Tau-protein kinase activity	IDA	21985311
GO:0050321	Function	Tau-protein kinase activity	ISS
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0050770	Process	Regulation of axonogenesis	ISS
GO:0051117	Function	ATPase binding	IDA	23907667
GO:0051301	Process	Cell division	IEA
GO:0060590	Function	ATPase regulator activity	NAS	23907667
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	IMP	22669945
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	22713462
GO:0090176	Process	Microtubule cytoskeleton organization involved in establishment of planar polarity	IEA
GO:0090176	Process	Microtubule cytoskeleton organization involved in establishment of planar polarity	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0150034	Component	Distal axon	ISS
GO:1904152	Process	Regulation of retrograde protein transport, ER to cytosol	IC	23907667
GO:1904152	Process	Regulation of retrograde protein transport, ER to cytosol	NAS	23907667
GO:2000807	Process	Regulation of synaptic vesicle clustering	IEA
GO:2000807	Process	Regulation of synaptic vesicle clustering	TAS	18268107

MIM	HGNC	e!Ensembl
609236	11405	ENSG00000174672

Q8IWQ3

Protein name

Serine/threonine-protein kinase BRSK2 (EC 2.7.11.1) (Brain-selective kinase 2) (EC 2.7.11.26) (Brain-specific serine/threonine-protein kinase 2) (BR serine/threonine-protein kinase 2) (Serine/threonine-protein kinase 29) (Serine/threonine-protein kinase S

Protein function

Serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. Phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	19 → 270	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in pancreas islets (at protein level). {ECO:0000269|PubMed:22798068}.

Sequence

MTSTGKDGGAQHAQYVGPYRLEKTLGKGQTGLVKLGVHCVTCQKVAIKIVNREKLSESVL
MKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARK
FFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPH
YACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIP
PDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRKVQIRSLPSLEDIDP
DVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDP
PRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHGQRSRSISGASSGL
STSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRARLN
SIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKD
KPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGE
AQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSDTTNCMEMMTGRLS
KCGSPLSNFFDVIKQLFSDEKNGQAAQAPSTPAKRSAHGPLGDSAAAGPGPGGDAEYPTG
KDTAKMGPPTARREQP

Sequence length

736

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
BRSK2-related disorder	Likely pathogenic; Pathogenic	rs2133120033, rs1851486514	RCV002251108 RCV004529280	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Likely pathogenic	rs2539739333	RCV003331465	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2539740546	RCV003387584	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOSOMAL DOMINANT NON-SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRSK2-related Intellectual Disability and Autism	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	CTD, ClinGen	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HEMOLYTIC ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Apraxia of Phonation	Apraxia	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GENOMICS_ENGLAND_DG	28135719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	30879638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant non-syndromic intellectual disability	Non-Syndromic Intellectual Disability	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	30675193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33540684, 39849389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30675193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	36499607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30879638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	30879638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30282980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	GENOMICS_ENGLAND_DG	28135719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gross motor development delay	Developmental delay	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	30879638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	28135719		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Intellectual developmental disorder	Pubtator	30879638	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Language Development Disorders	Language development disorders	Pubtator	30879638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30675193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30675193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28591720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	CLINVAR_DG	30879638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30879638		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	GENOMICS_ENGLAND_DG	30879638		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28591720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28591720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16165222		★★★★★ ★☆☆☆☆ Found in Text Mining only

BRSK2 (BR serine/threonine kinase 2)