UCN2 (urocortin 2)

Gene

• Entrez ID: 90226
• Gene name: Urocortin 2
• Gene symbol: UCN2
• Synonyms (NCBI Gene): SRP, UCN-II, UCNI, UR, URP
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1472710	hsa-miR-103a	CLIP-seq
MIRT1472711	hsa-miR-107	CLIP-seq
MIRT1472712	hsa-miR-31	CLIP-seq
MIRT1472713	hsa-miR-3183	CLIP-seq
MIRT1472714	hsa-miR-34a	CLIP-seq
MIRT1472715	hsa-miR-34c-5p	CLIP-seq
MIRT1472716	hsa-miR-3622b-5p	CLIP-seq
MIRT1472717	hsa-miR-3688-5p	CLIP-seq
MIRT1472718	hsa-miR-4330	CLIP-seq
MIRT1472719	hsa-miR-4432	CLIP-seq
MIRT1472720	hsa-miR-449a	CLIP-seq
MIRT1472721	hsa-miR-449b	CLIP-seq
MIRT1472722	hsa-miR-4645-3p	CLIP-seq
MIRT1472723	hsa-miR-4696	CLIP-seq
MIRT1472724	hsa-miR-4716-5p	CLIP-seq
MIRT1472725	hsa-miR-4723-3p	CLIP-seq
MIRT1472726	hsa-miR-483-3p	CLIP-seq
MIRT1472727	hsa-miR-885-3p	CLIP-seq
MIRT2142343	hsa-miR-4496	CLIP-seq
MIRT2362878	hsa-miR-190	CLIP-seq
MIRT2362879	hsa-miR-190b	CLIP-seq
MIRT1472718	hsa-miR-4330	CLIP-seq
MIRT2442822	hsa-miR-138	CLIP-seq
MIRT2442823	hsa-miR-4315	CLIP-seq
MIRT2442824	hsa-miR-4790-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	11329063
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11329063
GO:0007586	Process	Digestion	IEA
GO:0007586	Process	Digestion	NAS	11329063
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	11329063
GO:0031669	Process	Cellular response to nutrient levels	IBA
GO:0042562	Function	Hormone binding	IPI	11329063
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IBA
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IPI	11329063
GO:0051431	Function	Corticotropin-releasing hormone receptor 2 binding	IEA

Other IDs

• MIM: 605902
• HGNC: 18414
• e!Ensembl: ENSG00000145040

Protein

• UniProt ID: Q96RP3
• Protein name: Urocortin-2 (Stresscopin-related peptide) (Urocortin II) (Ucn II) (Urocortin-related peptide)
• Protein function: Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
• PDB: 2RMG, 3N95
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00473	CRF	72 → 109	Corticotropin-releasing factor family	Family

• Sequence:

  MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
  HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC

• Sequence length: 112

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Class B/2 (Secretin family receptors)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	31100090		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31323387		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30639643		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	30133749		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	CTD_human_DG	17627984		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arnold Chiari Malformation	Arnold-Chiari malformation	BEFREE	30621833		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29499655		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31512017		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	25463664		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	28370949		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29713130		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24260200, 28929494		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28929494	Associate	★☆☆☆☆ Found in Text Mining only
Congenital absence of tibia	Tibial hemimelia	BEFREE	22499340		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	16330704		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	25760560, 28550160, 28887029, 29584808, 30003813, 31676153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	21360527		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	30863950		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28331982		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30639643		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31443094		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31443094		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31010957		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	27567427		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21454316		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	16330704		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	25760560, 28550160, 28887029, 29584808, 30003813, 31676153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	16330704		★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	22499340		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31443094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29584808		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	30639643		★☆☆☆☆ Found in Text Mining only
Jeune thoracic dystrophy	Jeune Thoracic Dystrophy	BEFREE	27925158		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	29499655	Inhibit	★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	16330704		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29499655		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29453582, 29499655		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29330505		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	16330704		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	21377315, 28331982		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24260200, 28851616		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31010957		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	28851616		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27841039		★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	27925158		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29584808		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21360527		★☆☆☆☆ Found in Text Mining only
Saldino-Noonan Syndrome	Asphyxiating thoracic dystrophy	BEFREE	27925158		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	29349511		★☆☆☆☆ Found in Text Mining only
Short Rib-Polydactyly Syndrome	Short Rib-Polydactyly Syndrome	BEFREE	22499340		★☆☆☆☆ Found in Text Mining only