Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	90139
Gene name	Tetraspanin 18
Gene symbol	TSPAN18
Synonyms (NCBI Gene)	TSPAN
Chromosome	11
Chromosome location	11p11.2

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049631	hsa-miR-92a-3p	CLASH	23622248
MIRT040497	hsa-miR-597-5p	CLASH	23622248
MIRT439384	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439384	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1459669	hsa-miR-1197	CLIP-seq
MIRT1459670	hsa-miR-1264	CLIP-seq
MIRT1459671	hsa-miR-1265	CLIP-seq
MIRT1459672	hsa-miR-182	CLIP-seq
MIRT1459673	hsa-miR-202	CLIP-seq
MIRT1459674	hsa-miR-2682	CLIP-seq
MIRT1459675	hsa-miR-31	CLIP-seq
MIRT1459676	hsa-miR-3184	CLIP-seq
MIRT1459677	hsa-miR-331-3p	CLIP-seq
MIRT1459678	hsa-miR-370	CLIP-seq
MIRT1459679	hsa-miR-3940-5p	CLIP-seq
MIRT1459680	hsa-miR-423-5p	CLIP-seq
MIRT1459681	hsa-miR-4269	CLIP-seq
MIRT1459682	hsa-miR-4308	CLIP-seq
MIRT1459683	hsa-miR-431	CLIP-seq
MIRT1459684	hsa-miR-4434	CLIP-seq
MIRT1459685	hsa-miR-4468	CLIP-seq
MIRT1459686	hsa-miR-449c	CLIP-seq
MIRT1459687	hsa-miR-4507	CLIP-seq
MIRT1459688	hsa-miR-4514	CLIP-seq
MIRT1459689	hsa-miR-4516	CLIP-seq
MIRT1459690	hsa-miR-4531	CLIP-seq
MIRT1459691	hsa-miR-4688	CLIP-seq
MIRT1459692	hsa-miR-4692	CLIP-seq
MIRT1459693	hsa-miR-4696	CLIP-seq
MIRT1459694	hsa-miR-4709-3p	CLIP-seq
MIRT1459695	hsa-miR-4728-5p	CLIP-seq
MIRT1459696	hsa-miR-4738-3p	CLIP-seq
MIRT1459697	hsa-miR-4742-5p	CLIP-seq
MIRT1459698	hsa-miR-4749-3p	CLIP-seq
MIRT1459699	hsa-miR-4757-5p	CLIP-seq
MIRT1459700	hsa-miR-564	CLIP-seq
MIRT1459701	hsa-miR-653	CLIP-seq
MIRT1459702	hsa-miR-661	CLIP-seq
MIRT1555209	hsa-miR-1253	CLIP-seq
MIRT1555210	hsa-miR-185	CLIP-seq
MIRT1555211	hsa-miR-3175	CLIP-seq
MIRT1555212	hsa-miR-3911	CLIP-seq
MIRT1555213	hsa-miR-4254	CLIP-seq
MIRT1555214	hsa-miR-4292	CLIP-seq
MIRT1555215	hsa-miR-4306	CLIP-seq
MIRT1555216	hsa-miR-4644	CLIP-seq
MIRT1459695	hsa-miR-4728-5p	CLIP-seq
MIRT1555217	hsa-miR-485-5p	CLIP-seq
MIRT1555209	hsa-miR-1253	CLIP-seq
MIRT1555210	hsa-miR-185	CLIP-seq
MIRT2137954	hsa-miR-2110	CLIP-seq
MIRT2137955	hsa-miR-3126-5p	CLIP-seq
MIRT2137956	hsa-miR-3140-5p	CLIP-seq
MIRT1555215	hsa-miR-4306	CLIP-seq
MIRT1555216	hsa-miR-4644	CLIP-seq
MIRT2137957	hsa-miR-4659a-3p	CLIP-seq
MIRT2137958	hsa-miR-4659b-3p	CLIP-seq
MIRT1459694	hsa-miR-4709-3p	CLIP-seq
MIRT2358868	hsa-miR-147	CLIP-seq
MIRT2358869	hsa-miR-2113	CLIP-seq
MIRT2358870	hsa-miR-2278	CLIP-seq
MIRT1459677	hsa-miR-331-3p	CLIP-seq
MIRT2358871	hsa-miR-3919	CLIP-seq
MIRT2358872	hsa-miR-4274	CLIP-seq
MIRT1555214	hsa-miR-4292	CLIP-seq
MIRT2358873	hsa-miR-4756-3p	CLIP-seq
MIRT2358874	hsa-miR-4793-5p	CLIP-seq
MIRT2358875	hsa-miR-592	CLIP-seq
MIRT2358876	hsa-miR-597	CLIP-seq
MIRT2358877	hsa-miR-599	CLIP-seq
MIRT1555217	hsa-miR-485-5p	CLIP-seq
MIRT2358870	hsa-miR-2278	CLIP-seq
MIRT2652087	hsa-miR-3670	CLIP-seq
MIRT2358872	hsa-miR-4274	CLIP-seq
MIRT2652088	hsa-miR-455-3p	CLIP-seq
MIRT2652089	hsa-miR-556-5p	CLIP-seq
MIRT2358870	hsa-miR-2278	CLIP-seq
MIRT2694352	hsa-miR-29a	CLIP-seq
MIRT2694353	hsa-miR-29b	CLIP-seq
MIRT2694354	hsa-miR-29c	CLIP-seq
MIRT2694355	hsa-miR-3663-3p	CLIP-seq
MIRT2694356	hsa-miR-3922-5p	CLIP-seq
MIRT2358872	hsa-miR-4274	CLIP-seq
MIRT2652088	hsa-miR-455-3p	CLIP-seq
MIRT2694357	hsa-miR-4650-5p	CLIP-seq
MIRT2694358	hsa-miR-4753-5p	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 30573509, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0016020	Component	Membrane	IEA
GO:0017156	Process	Calcium-ion regulated exocytosis	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:1903670	Process	Regulation of sprouting angiogenesis	IMP	32694189

MIM	HGNC	e!Ensembl
619399	20660	ENSG00000157570

Q96SJ8

Protein name

Tetraspanin-18 (Tspan-18)

Protein function

Plays a role in the cell surface localization of ORAI1 and may participate in the regulation of Ca(2+) signaling and the VWF release in response to inflammatory stimuli.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	9 → 246	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in primary endothelial cells (PubMed:30573509, PubMed:32694189). Expressed in the embryo heart (PubMed:32694189). Weakly expressed the embryo skeletal muscle (PubMed:32694189). {ECO:0000269|PubMed:30573509, ECO:0000269

Sequence

MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLA
MGGLLFLLGFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKE
LTKHYQGNNDTDVFSATWNSVMITFGCCGVNGPEDFKFASVFRLLTLDSEEVPEACCRRE
PQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIELFAMIFA
MCLFRGIQ

Sequence length

248

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TSPAN18-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	26637991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15788668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15788668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34065085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	30573509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30720116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30720116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30720116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30720116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27996312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37542345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22037552, 23505562, 26016498, 27208512, 27312590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	22037552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	22037552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	22037552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30941828	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	GWASCAT_DG	26977737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28258189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TSPAN18 (tetraspanin 18)