Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	90102
Gene name	Pleckstrin homology like domain family B member 2
Gene symbol	PHLDB2
Synonyms (NCBI Gene)	LL5bLL5beta
Chromosome	3
Chromosome location	3q13.2

Show/Hide all (81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001432	hsa-miR-16-5p	pSILAC	18668040
MIRT023789	hsa-miR-1-3p	Proteomics	18668040
MIRT001432	hsa-miR-16-5p	Proteomics	18668040
MIRT439984	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT439983	hsa-miR-376a-5p	HITS-CLIP	24374217
MIRT439981	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT439984	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT439983	hsa-miR-376a-5p	HITS-CLIP	24374217
MIRT439981	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT1232102	hsa-miR-124	CLIP-seq
MIRT1232103	hsa-miR-1323	CLIP-seq
MIRT1232104	hsa-miR-3662	CLIP-seq
MIRT1232105	hsa-miR-3714	CLIP-seq
MIRT1232106	hsa-miR-3910	CLIP-seq
MIRT1232107	hsa-miR-506	CLIP-seq
MIRT1232108	hsa-miR-548o	CLIP-seq
MIRT1232109	hsa-miR-1208	CLIP-seq
MIRT1232110	hsa-miR-1297	CLIP-seq
MIRT1232111	hsa-miR-205	CLIP-seq
MIRT1232112	hsa-miR-2355-3p	CLIP-seq
MIRT1232113	hsa-miR-26a	CLIP-seq
MIRT1232114	hsa-miR-26b	CLIP-seq
MIRT1232115	hsa-miR-4420	CLIP-seq
MIRT1232116	hsa-miR-4465	CLIP-seq
MIRT1232117	hsa-miR-4668-3p	CLIP-seq
MIRT1232118	hsa-miR-676	CLIP-seq
MIRT2068117	hsa-miR-1272	CLIP-seq
MIRT2068118	hsa-miR-1322	CLIP-seq
MIRT2068119	hsa-miR-197	CLIP-seq
MIRT2068120	hsa-miR-2964a-5p	CLIP-seq
MIRT2068121	hsa-miR-3119	CLIP-seq
MIRT2068122	hsa-miR-338-5p	CLIP-seq
MIRT2068123	hsa-miR-4263	CLIP-seq
MIRT2068124	hsa-miR-4517	CLIP-seq
MIRT2068125	hsa-miR-4799-5p	CLIP-seq
MIRT2068126	hsa-miR-490-3p	CLIP-seq
MIRT2068127	hsa-miR-5096	CLIP-seq
MIRT2068128	hsa-miR-576-5p	CLIP-seq
MIRT2068129	hsa-miR-649	CLIP-seq
MIRT2068130	hsa-miR-759	CLIP-seq
MIRT1232109	hsa-miR-1208	CLIP-seq
MIRT1232110	hsa-miR-1297	CLIP-seq
MIRT1232111	hsa-miR-205	CLIP-seq
MIRT1232112	hsa-miR-2355-3p	CLIP-seq
MIRT1232113	hsa-miR-26a	CLIP-seq
MIRT1232114	hsa-miR-26b	CLIP-seq
MIRT1232115	hsa-miR-4420	CLIP-seq
MIRT1232116	hsa-miR-4465	CLIP-seq
MIRT1232117	hsa-miR-4668-3p	CLIP-seq
MIRT1232118	hsa-miR-676	CLIP-seq
MIRT2392492	hsa-miR-3692	CLIP-seq
MIRT2456398	hsa-miR-2116	CLIP-seq
MIRT2456399	hsa-miR-4255	CLIP-seq
MIRT2456400	hsa-miR-4677-5p	CLIP-seq
MIRT2456401	hsa-miR-4698	CLIP-seq
MIRT2456402	hsa-miR-570	CLIP-seq
MIRT2456403	hsa-miR-9	CLIP-seq
MIRT2593127	hsa-miR-1283	CLIP-seq
MIRT2593128	hsa-miR-1285	CLIP-seq
MIRT2593129	hsa-miR-1343	CLIP-seq
MIRT2593130	hsa-miR-3074-5p	CLIP-seq
MIRT2593131	hsa-miR-3117-5p	CLIP-seq
MIRT2593132	hsa-miR-3187-5p	CLIP-seq
MIRT2593133	hsa-miR-3945	CLIP-seq
MIRT2593134	hsa-miR-4253	CLIP-seq
MIRT2593135	hsa-miR-450a	CLIP-seq
MIRT2593136	hsa-miR-518a-5p	CLIP-seq
MIRT2593137	hsa-miR-527	CLIP-seq
MIRT2593138	hsa-miR-579	CLIP-seq
MIRT2593139	hsa-miR-612	CLIP-seq
MIRT2593140	hsa-miR-616	CLIP-seq
MIRT2593128	hsa-miR-1285	CLIP-seq
MIRT2593129	hsa-miR-1343	CLIP-seq
MIRT2593130	hsa-miR-3074-5p	CLIP-seq
MIRT2593131	hsa-miR-3117-5p	CLIP-seq
MIRT2593132	hsa-miR-3187-5p	CLIP-seq
MIRT2593133	hsa-miR-3945	CLIP-seq
MIRT2593134	hsa-miR-4253	CLIP-seq
MIRT2593136	hsa-miR-518a-5p	CLIP-seq
MIRT2593137	hsa-miR-527	CLIP-seq
MIRT2593139	hsa-miR-612	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	24859005
GO:0002102	Component	Podosome	IDA	23525008
GO:0002102	Component	Podosome	IEA
GO:0005515	Function	Protein binding	IPI	20236936, 23525008, 26496610
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	IDA	24859005
GO:0005938	Component	Cell cortex	IDA	24120883
GO:0005938	Component	Cell cortex	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0031252	Component	Cell leading edge	IDA	24859005
GO:0042995	Component	Cell projection	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045180	Component	Basal cortex	IBA
GO:0045180	Component	Basal cortex	IDA	23940118
GO:0045184	Process	Establishment of protein localization	IMP	24859005
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0051497	Process	Negative regulation of stress fiber assembly	IMP	24859005
GO:0051895	Process	Negative regulation of focal adhesion assembly	IMP	24859005
GO:0070161	Component	Anchoring junction	IEA
GO:0071711	Process	Basement membrane organization	IGI	23940118
GO:0071711	Process	Basement membrane organization	IMP	23940118
GO:1903690	Process	Negative regulation of wound healing, spreading of epidermal cells	IMP	24859005

MIM	HGNC	e!Ensembl
610298	29573	ENSG00000144824

Q86SQ0

Protein name

Pleckstrin homology-like domain family B member 2 (Protein LL5-beta)

Protein function

Seems to be involved in the assembly of the postsynaptic apparatus. May play a role in acetyl-choline receptor (AChR) aggregation in the postsynaptic membrane (By similarity).

PDB

8WHJ , 8WHK , 8WHM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	1144 → 1245	PH domain	Domain

Sequence

MEEHSYIQKELDLQNGSLEEDSVVHSVENDSQNMMESLSPKKYSSSLRFKANGDYSGSYL
TLSQPVPAKRSPSPLGTSVRSSPSLAKIQGSKQFSYDGTDKNIPMKPPTPLLNTTSSLSG
YPLGRADFDHYTGRDSERALRLSEKPPYSKYSSRHKSHDNVYSLGGLEGRKASGSLLAMW
NGSSLSDAGPPPISRSGAASMPSSPKQARKMSIQDSLALQPKLTRHKELASENINLRTRK
YSSSSLSHMGAYSRSLPRLYRATENQLTPLSLPPRNSLGNSKRTKLGEKDLPHSVIDNDN
YLNFSSLSSGALPYKTSASEGNPYVSSTLSVPASPRVARKMLLASTSSCASDDFDQASYV
GTNPSHSLLAGESDRVFATRRNFSCGSVEFDEADLESLRQASGTPQPALRERKSSISSIS
GRDDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSRLSTGTTVEDVQKIN
KELEKLQLSDEESVFEEALMSPDTRYRCHRKDSLPDADLASCGSLSQSSASFFTPRSTRN
DELLSDLTRTPPPPSSTFPKASSESSYLSILPKTPEGISEEQRSQELAAMEETRIVILNN
LEELKQKIKDINDQMDESFRELDMECALLDGEQKSETTELMKEKEILDHLNRKIAELEKN
IVGEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESK
HFEDLEFQQLEHESRLDEEKENLTQQLLREVAEYQRNIVSRKEKISALKKQANHIVQQAQ
REQDHFVKEKNNLIMMLQREKENLCNLEKKYSSLSGGKGFPVNPNTLKEGYISVNEINEP
CGNSTNLSPSTQFPADADAVATEPATAVLASQPQSKEHFRSLEERKKQHKEGLYLSDTLP
RKKTTSSISPHFSSATMGRSITPKAHLPLGQSNSCGSVLPPSLAAMAKDSESRRMLRGYN
HQQMSEGHRQKSEFYNRTASESNVYLNSFHYPDHSYKDQAFDTLSLDSSDSMETSISACS
PDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRREILEKR
LQEETSQRQKLIEKEVKIRERQRAQARPLTRYLPVRKEDFDLRSHVETAGHNIDTCYHVS
ITEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVIYFQAIEEVYYD
HLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL

Sequence length

1253

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ILEOCOLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIANAL CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	33452458	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33320958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28392396, 31346319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31346319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34526059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	22111664, 25024308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37614011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	GWASCAT_DG	26151496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28392396, 31346319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28392396, 31346319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31346319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25791791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35655921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33452458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PHLDB2 (pleckstrin homology like domain family B member 2)