Gene Gene information from NCBI Gene database.
Entrez ID 901
Gene name Cyclin G2
Gene symbol CCNG2
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4q21.1
Summary The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of abou
miRNA miRNA information provided by mirtarbase database.
515
miRTarBase ID miRNA Experiments Reference
MIRT016825 hsa-miR-335-5p Microarray 18185580
MIRT027966 hsa-miR-93-5p Sequencing 20371350
MIRT041104 hsa-miR-503-5p CLASH 23622248
MIRT737381 hsa-miR-1246 Western blottingImmunohistochemistry (IHC)qRT-PCR 32196930
MIRT872060 hsa-let-7a CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
AHR Activation 22596188
FOXA1 Unknown 22596188
OTX2 Activation 21047732
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IBA
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603203 1593 ENSG00000138764
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16589
Protein name Cyclin-G2
Protein function May play a role in growth regulation and in negative regulation of cell cycle progression.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 20 154 Cyclin, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.
Sequence
MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKV
EDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIP
STHDVIRISQCKCTASDIKRMEKIISEKLHYELE
ATTALNFLHLYHTIILCHTSERKEIL
SLDKLEAQLKACNCRLIFSKAKPSVLALCLLNLEVETLKSVELLEILLLVKKHSKINDTE
FFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
ESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  FoxO signaling pathway
p53 signaling pathway
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SARCOIDOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCOLIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Astrocytoma Astrocytoma BEFREE 29720957
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 18025271, 29216623
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 22596188, 27753529 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 26876206 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 30115848
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 37204480 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 28975847
★☆☆☆☆
Found in Text Mining only
Carcinoma Ovarian Epithelial Epithelial ovarian carcinoma Pubtator 26876206 Inhibit
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 26876206
★☆☆☆☆
Found in Text Mining only
Colitis Ulcerative Ulcerative colitis Pubtator 18776587 Associate
★☆☆☆☆
Found in Text Mining only