Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	90070
Gene name	Lacritin
Gene symbol	LACRT
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q13.2
Summary	The protein encoded by this gene is highly expressed in the lacrimal glands and localized primarily to secretory granules and secretory fluid. It augments lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019336	hsa-miR-148b-3p	Microarray	17612493

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11419941, 16982797, 33961781
GO:0005518	Function	Collagen binding	IDA	11419941
GO:0005576	Component	Extracellular region	IDA	17850790
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0008083	Function	Growth factor activity	IDA	16982797
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11419941, 16982797
GO:0010669	Process	Epithelial structure maintenance	IDA	25034600
GO:0016239	Process	Positive regulation of macroautophagy	IDA	23640897
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019722	Process	Calcium-mediated signaling	IDA	11419941, 16923831
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IDA	11419941
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	26670139
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	16923831
GO:0034067	Process	Protein localization to Golgi apparatus	IDA	16923831
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IDA	24942736
GO:0043066	Process	Negative regulation of apoptotic process	IDA	26670139
GO:0043237	Function	Laminin-1 binding	IDA	11419941
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	16923831
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	11419941
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	25530855
GO:0051047	Process	Positive regulation of secretion	IDA	11419941
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	16923831
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	IDA	25530855
GO:0070075	Process	Tear secretion	IDA	25034600, 25481446
GO:0070075	Process	Tear secretion	NAS	18840430
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IDA	16923831

MIM	HGNC	e!Ensembl
607360	16430	ENSG00000135413

Q9GZZ8

Protein name

Extracellular glycoprotein lacritin

Protein function

Modulates secretion by lacrimal acinar cells.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in secretory granules of many acinar cells in lacrimal gland and in scattered acinar cells of salivary glands.

Sequence

MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTA
QETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENG
SEFAQKLLKKFSLLKPWA

Sequence length

138

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	27327445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14574570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	36677706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	23640897, 27436115, 31010136, 32879769, 36677706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	32879769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28419103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14574570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31010136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28419103		★★★★★ ★☆☆☆☆ Found in Text Mining only

LACRT (lacritin)