Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9002
Gene name	F2R like thrombin or trypsin receptor 3
Gene symbol	F2RL3
Synonyms (NCBI Gene)	PAR4
Chromosome	19
Chromosome location	19p13.11
Summary	This gene encodes a member of the protease-activated receptor subfamily, part of the G-protein coupled receptor 1 family of proteins. The encoded receptor is proteolytically processed to reveal an extracellular N-terminal tethered ligand that binds to and

374

Show/Hide all (374)

miRTarBase ID	miRNA	Experiments	Reference
MIRT519209	hsa-miR-759	HITS-CLIP	23824327
MIRT664999	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT664998	hsa-miR-8073	HITS-CLIP	23824327
MIRT519202	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT664997	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT664996	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT664995	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT664994	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT664993	hsa-miR-498	HITS-CLIP	23824327
MIRT552213	hsa-miR-3609	PAR-CLIP	21572407
MIRT552212	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT552211	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT552210	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT552209	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT552208	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT552207	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT552206	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT552205	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT552204	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT552203	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT552202	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT552201	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT552200	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT552199	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT552198	hsa-miR-302e	PAR-CLIP	21572407
MIRT552197	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT552196	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT552195	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT552194	hsa-miR-520b	PAR-CLIP	21572407
MIRT552193	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT552192	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT552191	hsa-miR-520e	PAR-CLIP	21572407
MIRT552190	hsa-miR-4438	PAR-CLIP	21572407
MIRT552189	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT552188	hsa-miR-619-5p	PAR-CLIP	21572407
MIRT552187	hsa-miR-6506-5p	PAR-CLIP	21572407
MIRT552186	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT552185	hsa-miR-2682-3p	PAR-CLIP	21572407
MIRT552184	hsa-miR-6781-3p	PAR-CLIP	21572407
MIRT552183	hsa-miR-4731-5p	PAR-CLIP	21572407
MIRT552182	hsa-miR-5589-5p	PAR-CLIP	21572407
MIRT552181	hsa-miR-4757-5p	PAR-CLIP	21572407
MIRT552180	hsa-miR-6744-3p	PAR-CLIP	21572407
MIRT552179	hsa-miR-5095	PAR-CLIP	21572407
MIRT552178	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT552176	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT519211	hsa-miR-3186-5p	PAR-CLIP	23446348
MIRT519210	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT519208	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT519209	hsa-miR-759	PAR-CLIP	23446348
MIRT519207	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT519206	hsa-miR-3130-3p	PAR-CLIP	23446348
MIRT519204	hsa-miR-5186	PAR-CLIP	23446348
MIRT519205	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT519203	hsa-miR-4252	PAR-CLIP	23446348
MIRT519202	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT519201	hsa-miR-4663	PAR-CLIP	23446348
MIRT519200	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT519199	hsa-miR-8077	PAR-CLIP	23446348
MIRT519198	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT519197	hsa-miR-500a-3p	PAR-CLIP	23446348
MIRT461846	hsa-miR-596	PAR-CLIP	23592263
MIRT461845	hsa-miR-4779	PAR-CLIP	23592263
MIRT461844	hsa-miR-9500	PAR-CLIP	23592263
MIRT461843	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT461842	hsa-miR-1205	PAR-CLIP	23592263
MIRT461841	hsa-miR-3665	PAR-CLIP	23592263
MIRT461840	hsa-miR-657	PAR-CLIP	23592263
MIRT461839	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT461838	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT461837	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT461836	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT519209	hsa-miR-759	HITS-CLIP	23824327
MIRT664999	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT664998	hsa-miR-8073	HITS-CLIP	23824327
MIRT519202	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT664997	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT664996	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT664995	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT664994	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT664993	hsa-miR-498	HITS-CLIP	23824327
MIRT552213	hsa-miR-3609	PAR-CLIP	21572407
MIRT552212	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT552211	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT552210	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT552209	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT552208	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT552207	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT552206	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT552205	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT552204	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT552203	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT552202	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT552201	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT552200	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT552199	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT552198	hsa-miR-302e	PAR-CLIP	21572407
MIRT552197	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT552196	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT552195	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT552194	hsa-miR-520b	PAR-CLIP	21572407
MIRT552193	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT552192	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT552191	hsa-miR-520e	PAR-CLIP	21572407
MIRT552190	hsa-miR-4438	PAR-CLIP	21572407
MIRT552189	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT552188	hsa-miR-619-5p	PAR-CLIP	21572407
MIRT552187	hsa-miR-6506-5p	PAR-CLIP	21572407
MIRT552186	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT552185	hsa-miR-2682-3p	PAR-CLIP	21572407
MIRT552184	hsa-miR-6781-3p	PAR-CLIP	21572407
MIRT552183	hsa-miR-4731-5p	PAR-CLIP	21572407
MIRT552182	hsa-miR-5589-5p	PAR-CLIP	21572407
MIRT552181	hsa-miR-4757-5p	PAR-CLIP	21572407
MIRT552180	hsa-miR-6744-3p	PAR-CLIP	21572407
MIRT552179	hsa-miR-5095	PAR-CLIP	21572407
MIRT552178	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT552176	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT519211	hsa-miR-3186-5p	PAR-CLIP	23446348
MIRT519210	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT519208	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT519209	hsa-miR-759	PAR-CLIP	23446348
MIRT519207	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT519206	hsa-miR-3130-3p	PAR-CLIP	23446348
MIRT519204	hsa-miR-5186	PAR-CLIP	23446348
MIRT519205	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT519203	hsa-miR-4252	PAR-CLIP	23446348
MIRT519202	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT519201	hsa-miR-4663	PAR-CLIP	23446348
MIRT519200	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT519199	hsa-miR-8077	PAR-CLIP	23446348
MIRT519198	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT519197	hsa-miR-500a-3p	PAR-CLIP	23446348
MIRT461846	hsa-miR-596	PAR-CLIP	23592263
MIRT461845	hsa-miR-4779	PAR-CLIP	23592263
MIRT461844	hsa-miR-9500	PAR-CLIP	23592263
MIRT461843	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT461842	hsa-miR-1205	PAR-CLIP	23592263
MIRT461841	hsa-miR-3665	PAR-CLIP	23592263
MIRT461840	hsa-miR-657	PAR-CLIP	23592263
MIRT461839	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT461838	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT461837	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT461836	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT974493	hsa-miR-103b	CLIP-seq
MIRT974494	hsa-miR-106a	CLIP-seq
MIRT974495	hsa-miR-106b	CLIP-seq
MIRT974496	hsa-miR-122	CLIP-seq
MIRT974497	hsa-miR-1267	CLIP-seq
MIRT974498	hsa-miR-17	CLIP-seq
MIRT974499	hsa-miR-20a	CLIP-seq
MIRT974500	hsa-miR-20b	CLIP-seq
MIRT974501	hsa-miR-302a	CLIP-seq
MIRT974502	hsa-miR-302b	CLIP-seq
MIRT974503	hsa-miR-302c	CLIP-seq
MIRT974504	hsa-miR-302d	CLIP-seq
MIRT974505	hsa-miR-3135b	CLIP-seq
MIRT974506	hsa-miR-3149	CLIP-seq
MIRT974507	hsa-miR-3194-3p	CLIP-seq
MIRT974508	hsa-miR-3652	CLIP-seq
MIRT974509	hsa-miR-372	CLIP-seq
MIRT974510	hsa-miR-373	CLIP-seq
MIRT974511	hsa-miR-4281	CLIP-seq
MIRT974512	hsa-miR-431	CLIP-seq
MIRT974513	hsa-miR-4423-5p	CLIP-seq
MIRT974514	hsa-miR-4430	CLIP-seq
MIRT974515	hsa-miR-4735-5p	CLIP-seq
MIRT974516	hsa-miR-4772-3p	CLIP-seq
MIRT974517	hsa-miR-4775	CLIP-seq
MIRT974518	hsa-miR-4797-5p	CLIP-seq
MIRT974519	hsa-miR-519d	CLIP-seq
MIRT974520	hsa-miR-548ah	CLIP-seq
MIRT974521	hsa-miR-590-3p	CLIP-seq
MIRT974522	hsa-miR-767-5p	CLIP-seq
MIRT974523	hsa-miR-93	CLIP-seq
MIRT974493	hsa-miR-103b	CLIP-seq
MIRT974496	hsa-miR-122	CLIP-seq
MIRT1988727	hsa-miR-1245	CLIP-seq
MIRT1988728	hsa-miR-1289	CLIP-seq
MIRT1988729	hsa-miR-1307	CLIP-seq
MIRT1988730	hsa-miR-1825	CLIP-seq
MIRT1988731	hsa-miR-1915	CLIP-seq
MIRT1988732	hsa-miR-1976	CLIP-seq
MIRT1988733	hsa-miR-199a-5p	CLIP-seq
MIRT1988734	hsa-miR-199b-5p	CLIP-seq
MIRT974505	hsa-miR-3135b	CLIP-seq
MIRT974506	hsa-miR-3149	CLIP-seq
MIRT1988735	hsa-miR-3155	CLIP-seq
MIRT1988736	hsa-miR-3155b	CLIP-seq
MIRT1988737	hsa-miR-3176	CLIP-seq
MIRT1988738	hsa-miR-3198	CLIP-seq
MIRT1988739	hsa-miR-345	CLIP-seq
MIRT1988740	hsa-miR-3545-3p	CLIP-seq
MIRT974508	hsa-miR-3652	CLIP-seq
MIRT1988741	hsa-miR-3922-3p	CLIP-seq
MIRT1988742	hsa-miR-4279	CLIP-seq
MIRT1988743	hsa-miR-4284	CLIP-seq
MIRT1988744	hsa-miR-4294	CLIP-seq
MIRT1988745	hsa-miR-4309	CLIP-seq
MIRT974513	hsa-miR-4423-5p	CLIP-seq
MIRT974514	hsa-miR-4430	CLIP-seq
MIRT1988746	hsa-miR-4638-5p	CLIP-seq
MIRT1988747	hsa-miR-4680-5p	CLIP-seq
MIRT1988748	hsa-miR-4726-3p	CLIP-seq
MIRT974515	hsa-miR-4735-5p	CLIP-seq
MIRT974516	hsa-miR-4772-3p	CLIP-seq
MIRT974517	hsa-miR-4775	CLIP-seq
MIRT1988749	hsa-miR-484	CLIP-seq
MIRT974521	hsa-miR-590-3p	CLIP-seq
MIRT974493	hsa-miR-103b	CLIP-seq
MIRT2223138	hsa-miR-1200	CLIP-seq
MIRT974496	hsa-miR-122	CLIP-seq
MIRT1988727	hsa-miR-1245	CLIP-seq
MIRT974497	hsa-miR-1267	CLIP-seq
MIRT1988728	hsa-miR-1289	CLIP-seq
MIRT2223139	hsa-miR-1293	CLIP-seq
MIRT1988730	hsa-miR-1825	CLIP-seq
MIRT2223140	hsa-miR-1913	CLIP-seq
MIRT1988731	hsa-miR-1915	CLIP-seq
MIRT1988732	hsa-miR-1976	CLIP-seq
MIRT1988733	hsa-miR-199a-5p	CLIP-seq
MIRT1988734	hsa-miR-199b-5p	CLIP-seq
MIRT2223141	hsa-miR-2355-5p	CLIP-seq
MIRT2223142	hsa-miR-23a	CLIP-seq
MIRT2223143	hsa-miR-23b	CLIP-seq
MIRT2223144	hsa-miR-23c	CLIP-seq
MIRT974505	hsa-miR-3135b	CLIP-seq
MIRT1988735	hsa-miR-3155	CLIP-seq
MIRT1988736	hsa-miR-3155b	CLIP-seq
MIRT974507	hsa-miR-3194-3p	CLIP-seq
MIRT1988738	hsa-miR-3198	CLIP-seq
MIRT2223145	hsa-miR-324-3p	CLIP-seq
MIRT1988739	hsa-miR-345	CLIP-seq
MIRT974508	hsa-miR-3652	CLIP-seq
MIRT2223146	hsa-miR-3974	CLIP-seq
MIRT2223147	hsa-miR-4264	CLIP-seq
MIRT1988742	hsa-miR-4279	CLIP-seq
MIRT974511	hsa-miR-4281	CLIP-seq
MIRT1988744	hsa-miR-4294	CLIP-seq
MIRT2223148	hsa-miR-4303	CLIP-seq
MIRT1988745	hsa-miR-4309	CLIP-seq
MIRT2223149	hsa-miR-4324	CLIP-seq
MIRT974513	hsa-miR-4423-5p	CLIP-seq
MIRT974514	hsa-miR-4430	CLIP-seq
MIRT2223150	hsa-miR-4483	CLIP-seq
MIRT2223151	hsa-miR-4649-3p	CLIP-seq
MIRT1988748	hsa-miR-4726-3p	CLIP-seq
MIRT974515	hsa-miR-4735-5p	CLIP-seq
MIRT974516	hsa-miR-4772-3p	CLIP-seq
MIRT974517	hsa-miR-4775	CLIP-seq
MIRT1988749	hsa-miR-484	CLIP-seq
MIRT2223152	hsa-miR-512-5p	CLIP-seq
MIRT2223153	hsa-miR-541	CLIP-seq
MIRT2223154	hsa-miR-544b	CLIP-seq
MIRT974521	hsa-miR-590-3p	CLIP-seq
MIRT2223155	hsa-miR-622	CLIP-seq
MIRT2223156	hsa-miR-640	CLIP-seq
MIRT2223157	hsa-miR-654-5p	CLIP-seq
MIRT974493	hsa-miR-103b	CLIP-seq
MIRT974494	hsa-miR-106a	CLIP-seq
MIRT974495	hsa-miR-106b	CLIP-seq
MIRT974496	hsa-miR-122	CLIP-seq
MIRT2387597	hsa-miR-1234	CLIP-seq
MIRT1988727	hsa-miR-1245	CLIP-seq
MIRT974498	hsa-miR-17	CLIP-seq
MIRT1988731	hsa-miR-1915	CLIP-seq
MIRT974499	hsa-miR-20a	CLIP-seq
MIRT974500	hsa-miR-20b	CLIP-seq
MIRT974501	hsa-miR-302a	CLIP-seq
MIRT974502	hsa-miR-302b	CLIP-seq
MIRT974503	hsa-miR-302c	CLIP-seq
MIRT974504	hsa-miR-302d	CLIP-seq
MIRT974505	hsa-miR-3135b	CLIP-seq
MIRT1988735	hsa-miR-3155	CLIP-seq
MIRT1988736	hsa-miR-3155b	CLIP-seq
MIRT974508	hsa-miR-3652	CLIP-seq
MIRT974509	hsa-miR-372	CLIP-seq
MIRT974510	hsa-miR-373	CLIP-seq
MIRT2387598	hsa-miR-4258	CLIP-seq
MIRT2387599	hsa-miR-4297	CLIP-seq
MIRT974513	hsa-miR-4423-5p	CLIP-seq
MIRT974514	hsa-miR-4430	CLIP-seq
MIRT1988748	hsa-miR-4726-3p	CLIP-seq
MIRT1988749	hsa-miR-484	CLIP-seq
MIRT974519	hsa-miR-519d	CLIP-seq
MIRT2387600	hsa-miR-520g	CLIP-seq
MIRT2387601	hsa-miR-520h	CLIP-seq
MIRT974522	hsa-miR-767-5p	CLIP-seq
MIRT974523	hsa-miR-93	CLIP-seq
MIRT974496	hsa-miR-122	CLIP-seq
MIRT974497	hsa-miR-1267	CLIP-seq
MIRT2449034	hsa-miR-1273f	CLIP-seq
MIRT2449035	hsa-miR-1281	CLIP-seq
MIRT1988731	hsa-miR-1915	CLIP-seq
MIRT974505	hsa-miR-3135b	CLIP-seq
MIRT974506	hsa-miR-3149	CLIP-seq
MIRT2449036	hsa-miR-3170	CLIP-seq
MIRT974507	hsa-miR-3194-3p	CLIP-seq
MIRT2449037	hsa-miR-3529	CLIP-seq
MIRT974508	hsa-miR-3652	CLIP-seq
MIRT2449038	hsa-miR-379	CLIP-seq
MIRT974512	hsa-miR-431	CLIP-seq
MIRT974513	hsa-miR-4423-5p	CLIP-seq
MIRT974514	hsa-miR-4430	CLIP-seq
MIRT2449039	hsa-miR-4451	CLIP-seq
MIRT2449040	hsa-miR-4650-3p	CLIP-seq
MIRT2449041	hsa-miR-4712-5p	CLIP-seq
MIRT1988748	hsa-miR-4726-3p	CLIP-seq
MIRT974515	hsa-miR-4735-5p	CLIP-seq
MIRT974517	hsa-miR-4775	CLIP-seq
MIRT2449042	hsa-miR-4794	CLIP-seq
MIRT2449043	hsa-miR-552	CLIP-seq
MIRT974521	hsa-miR-590-3p	CLIP-seq
MIRT2449044	hsa-miR-624	CLIP-seq
MIRT2449045	hsa-miR-764	CLIP-seq
MIRT2449046	hsa-miR-770-5p	CLIP-seq
MIRT974506	hsa-miR-3149	CLIP-seq
MIRT2449037	hsa-miR-3529	CLIP-seq
MIRT2449038	hsa-miR-379	CLIP-seq
MIRT2449039	hsa-miR-4451	CLIP-seq
MIRT2449040	hsa-miR-4650-3p	CLIP-seq
MIRT974515	hsa-miR-4735-5p	CLIP-seq
MIRT974517	hsa-miR-4775	CLIP-seq
MIRT974521	hsa-miR-590-3p	CLIP-seq
MIRT974493	hsa-miR-103b	CLIP-seq
MIRT974496	hsa-miR-122	CLIP-seq
MIRT974497	hsa-miR-1267	CLIP-seq
MIRT2449035	hsa-miR-1281	CLIP-seq
MIRT1988731	hsa-miR-1915	CLIP-seq
MIRT1988732	hsa-miR-1976	CLIP-seq
MIRT974505	hsa-miR-3135b	CLIP-seq
MIRT974506	hsa-miR-3149	CLIP-seq
MIRT974507	hsa-miR-3194-3p	CLIP-seq
MIRT1988739	hsa-miR-345	CLIP-seq
MIRT2449037	hsa-miR-3529	CLIP-seq
MIRT974508	hsa-miR-3652	CLIP-seq
MIRT2449038	hsa-miR-379	CLIP-seq
MIRT1988742	hsa-miR-4279	CLIP-seq
MIRT974512	hsa-miR-431	CLIP-seq
MIRT974513	hsa-miR-4423-5p	CLIP-seq
MIRT974514	hsa-miR-4430	CLIP-seq
MIRT2449039	hsa-miR-4451	CLIP-seq
MIRT2449040	hsa-miR-4650-3p	CLIP-seq
MIRT1988748	hsa-miR-4726-3p	CLIP-seq
MIRT974515	hsa-miR-4735-5p	CLIP-seq
MIRT974517	hsa-miR-4775	CLIP-seq
MIRT2449042	hsa-miR-4794	CLIP-seq
MIRT974521	hsa-miR-590-3p	CLIP-seq
MIRT2449044	hsa-miR-624	CLIP-seq
MIRT974493	hsa-miR-103b	CLIP-seq
MIRT974496	hsa-miR-122	CLIP-seq
MIRT974497	hsa-miR-1267	CLIP-seq
MIRT2449035	hsa-miR-1281	CLIP-seq
MIRT1988731	hsa-miR-1915	CLIP-seq
MIRT1988732	hsa-miR-1976	CLIP-seq
MIRT974505	hsa-miR-3135b	CLIP-seq
MIRT974506	hsa-miR-3149	CLIP-seq
MIRT974507	hsa-miR-3194-3p	CLIP-seq
MIRT1988739	hsa-miR-345	CLIP-seq
MIRT2449037	hsa-miR-3529	CLIP-seq
MIRT974508	hsa-miR-3652	CLIP-seq
MIRT2449038	hsa-miR-379	CLIP-seq
MIRT1988742	hsa-miR-4279	CLIP-seq
MIRT974512	hsa-miR-431	CLIP-seq
MIRT974513	hsa-miR-4423-5p	CLIP-seq
MIRT974514	hsa-miR-4430	CLIP-seq
MIRT2449039	hsa-miR-4451	CLIP-seq
MIRT2449040	hsa-miR-4650-3p	CLIP-seq
MIRT1988748	hsa-miR-4726-3p	CLIP-seq
MIRT974515	hsa-miR-4735-5p	CLIP-seq
MIRT974517	hsa-miR-4775	CLIP-seq
MIRT2449042	hsa-miR-4794	CLIP-seq
MIRT974521	hsa-miR-590-3p	CLIP-seq
MIRT2449044	hsa-miR-624	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	18434511
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9618465
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9618465
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	9618465
GO:0007596	Process	Blood coagulation	IEA
GO:0007596	Process	Blood coagulation	TAS	10500152
GO:0007599	Process	Hemostasis	IEA
GO:0009611	Process	Response to wounding	TAS	9618465
GO:0015057	Function	Thrombin-activated receptor activity	IEA
GO:0015057	Function	Thrombin-activated receptor activity	TAS	10500152
GO:0016020	Component	Membrane	IEA
GO:0030168	Process	Platelet activation	IDA	10702240
GO:0030168	Process	Platelet activation	IEA
GO:0030168	Process	Platelet activation	TAS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	18480058
GO:0060155	Process	Platelet dense granule organization	IC	18480058
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070527	Process	Platelet aggregation	IEA

MIM	HGNC	e!Ensembl
602779	3540	ENSG00000127533

Q96RI0

Protein name

Proteinase-activated receptor 4 (PAR-4) (Coagulation factor II receptor-like 3) (Thrombin receptor-like 3)

Protein function

Receptor for activated thrombin or trypsin coupled to G proteins that stimulate phosphoinositide hydrolysis (PubMed:10079109). May play a role in platelets activation (PubMed:10079109).

PDB

2ZPK , 3QDZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	94 → 340	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in lung, pancreas, thyroid, testis and small intestine. Not expressed in brain, kidney, spinal cord and peripheral blood leukocytes. Also detected in platelets.

Sequence

MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDT
LELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAA
ADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVH
PLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVLCHDALPLDAQASH
WQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAVVLASAVAFFVPSN
LLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSP
GDTVASKASAEGGSRGMGTHSSLLQ

Sequence length

385

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Neuroactive ligand-receptor interaction Complement and coagulation cascades Platelet activation Pathways in cancer		Peptide ligand-binding receptors G alpha (q) signalling events Thrombin signalling through proteinase activated receptors (PARs)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELIOSIS HEPATIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (105)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30574762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23886184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17893871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11742505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35012325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29207374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	12008957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	25278289, 29269513, 30055940, 30851630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23760770, 26977019, 29330285, 30148456, 31217499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19470463, 19625770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18650932, 23886184, 25821117, 26667048, 29722794, 31369996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28148395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37781030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26246468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	22228373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24510982, 31369996, 35012325, 35708029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26395445, 27038728, 29443899, 31369996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	15586236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12565819, 30347494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11742505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	20974703		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29695515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30271502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21635966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25876034, 29115593, 30333860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20056842, 21907696, 25876034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30462538	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	20724592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30271502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22511653, 23640490, 30574762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22511653, 23640490, 30574762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22511653, 23640490, 30574762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	12598324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10393834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18281137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29249425, 31759113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24586431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29249425, 31759113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30186877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17332319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25030438, 29977156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25030438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30363984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27901488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	30055940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	12008957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29249425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	22228373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30574762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20081107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20081107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29695020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10393834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22151913		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16966277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17323377, 25373316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17323377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10720740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27632354, 27924164, 29722794, 31369996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23840568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27901488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23760770, 26977019, 29330285, 30148456, 31217499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17332319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25030438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23886184, 25821117, 26667048, 29722794, 31369996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26246468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29672923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11585763, 12643472, 14755681, 14767530, 14965337, 19470463, 19625770, 21635966, 28494348, 9989812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21635966, 25876034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12565819, 17373694, 22552839, 22962598, 23760770, 24992930, 25001535, 25030438, 25231211, 28076793, 29207374, 29695515, 30333860, 30474528, 30518159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21635966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11742505		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25349262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18281137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	18281137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35012325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31337508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10562548, 11585763, 14767530, 17332319, 18836307, 19470463, 19625770, 20110331, 21555373, 22552839, 22962598, 23089203, 23886184, 24795528, 24992930 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28720068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14627703, 20927647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12565819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37233402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24795528		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26246468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29672923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	17893871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18427961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peliosis Hepatis	Peliosis Hepatis	CTD_human_DG	20974703		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23906015, 23975424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10393834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11585763, 12643472, 14755681, 14767530, 14965337, 19470463, 19625770, 28494348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17373694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25876034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	9989812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23739922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30271502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25690763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25030438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29502225, 30363984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21635966, 25876034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25876034	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29269513, 30462538, 32575122, 35054966, 35815338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29044290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	32575122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	32575122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

F2RL3 (F2R like thrombin or trypsin receptor 3)