HAP1 (huntingtin associated protein 1)

Gene

• Entrez ID: 9001
• Gene name: Huntingtin associated protein 1
• Gene symbol: HAP1
• Synonyms (NCBI Gene): HAP2, HIP5, HLP, hHLP1
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: Huntington`s disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein that interacts with huntingtin, with two cytosk

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT713241	hsa-miR-9500	HITS-CLIP	19536157
MIRT713240	hsa-miR-7-5p	HITS-CLIP	19536157
MIRT493688	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT493689	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT493687	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT493686	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT493685	hsa-miR-4784	PAR-CLIP	23592263
MIRT493684	hsa-miR-4419a	PAR-CLIP	23592263
MIRT493683	hsa-miR-4510	PAR-CLIP	23592263
MIRT493682	hsa-miR-6127	PAR-CLIP	23592263
MIRT493681	hsa-miR-6129	PAR-CLIP	23592263
MIRT493680	hsa-miR-6130	PAR-CLIP	23592263
MIRT493679	hsa-miR-6133	PAR-CLIP	23592263
MIRT493678	hsa-miR-298	PAR-CLIP	23592263
MIRT493677	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT493676	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT493675	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT493673	hsa-miR-8085	PAR-CLIP	23592263
MIRT493674	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT493672	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT493671	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT493670	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT713241	hsa-miR-9500	HITS-CLIP	19536157
MIRT713240	hsa-miR-7-5p	HITS-CLIP	19536157
MIRT493688	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT493689	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT493687	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT493686	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT493685	hsa-miR-4784	PAR-CLIP	23592263
MIRT493684	hsa-miR-4419a	PAR-CLIP	23592263
MIRT493683	hsa-miR-4510	PAR-CLIP	23592263
MIRT493682	hsa-miR-6127	PAR-CLIP	23592263
MIRT493681	hsa-miR-6129	PAR-CLIP	23592263
MIRT493680	hsa-miR-6130	PAR-CLIP	23592263
MIRT493679	hsa-miR-6133	PAR-CLIP	23592263
MIRT493678	hsa-miR-298	PAR-CLIP	23592263
MIRT493677	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT493676	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT493675	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT493673	hsa-miR-8085	PAR-CLIP	23592263
MIRT493674	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT493672	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT493671	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT493670	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT1040619	hsa-miR-1253	CLIP-seq
MIRT1040620	hsa-miR-3185	CLIP-seq
MIRT1040621	hsa-miR-4640-5p	CLIP-seq
MIRT1040622	hsa-miR-4726-5p	CLIP-seq
MIRT1040623	hsa-miR-4773	CLIP-seq
MIRT1040624	hsa-miR-7	CLIP-seq
MIRT1040625	hsa-miR-1197	CLIP-seq
MIRT1040626	hsa-miR-1207-5p	CLIP-seq
MIRT1040627	hsa-miR-1245b-5p	CLIP-seq
MIRT1040628	hsa-miR-1291	CLIP-seq
MIRT1040629	hsa-miR-1321	CLIP-seq
MIRT1040630	hsa-miR-138	CLIP-seq
MIRT1040631	hsa-miR-1587	CLIP-seq
MIRT1040632	hsa-miR-3142	CLIP-seq
MIRT1040633	hsa-miR-3151	CLIP-seq
MIRT1040634	hsa-miR-328	CLIP-seq
MIRT1040635	hsa-miR-4270	CLIP-seq
MIRT1040636	hsa-miR-4299	CLIP-seq
MIRT1040637	hsa-miR-4302	CLIP-seq
MIRT1040638	hsa-miR-4417	CLIP-seq
MIRT1040639	hsa-miR-4441	CLIP-seq
MIRT1040640	hsa-miR-4447	CLIP-seq
MIRT1040641	hsa-miR-4462	CLIP-seq
MIRT1040642	hsa-miR-4472	CLIP-seq
MIRT1040643	hsa-miR-4488	CLIP-seq
MIRT1040644	hsa-miR-4492	CLIP-seq
MIRT1040645	hsa-miR-4493	CLIP-seq
MIRT1040646	hsa-miR-4498	CLIP-seq
MIRT1040647	hsa-miR-4525	CLIP-seq
MIRT1040648	hsa-miR-4656	CLIP-seq
MIRT1040649	hsa-miR-4675	CLIP-seq
MIRT1040650	hsa-miR-4697-5p	CLIP-seq
MIRT1040651	hsa-miR-4739	CLIP-seq
MIRT1040652	hsa-miR-4741	CLIP-seq
MIRT1040653	hsa-miR-4756-5p	CLIP-seq
MIRT1040654	hsa-miR-4763-3p	CLIP-seq
MIRT1040655	hsa-miR-491-5p	CLIP-seq
MIRT1040656	hsa-miR-541	CLIP-seq
MIRT1040657	hsa-miR-542-3p	CLIP-seq
MIRT1040658	hsa-miR-654-5p	CLIP-seq
MIRT1040659	hsa-miR-762	CLIP-seq
MIRT1040626	hsa-miR-1207-5p	CLIP-seq
MIRT1040630	hsa-miR-138	CLIP-seq
MIRT2008507	hsa-miR-2467-3p	CLIP-seq
MIRT2008508	hsa-miR-3125	CLIP-seq
MIRT2008509	hsa-miR-3158-5p	CLIP-seq
MIRT2008510	hsa-miR-3678-3p	CLIP-seq
MIRT2008511	hsa-miR-3916	CLIP-seq
MIRT2008512	hsa-miR-4252	CLIP-seq
MIRT1040636	hsa-miR-4299	CLIP-seq
MIRT2008513	hsa-miR-4690-3p	CLIP-seq
MIRT1040654	hsa-miR-4763-3p	CLIP-seq
MIRT2008514	hsa-miR-486-3p	CLIP-seq
MIRT1040624	hsa-miR-7	CLIP-seq
MIRT2240957	hsa-miR-3120-3p	CLIP-seq
MIRT2240958	hsa-miR-627	CLIP-seq
MIRT2240959	hsa-miR-924	CLIP-seq
MIRT1040630	hsa-miR-138	CLIP-seq
MIRT1040631	hsa-miR-1587	CLIP-seq
MIRT2388897	hsa-miR-3184	CLIP-seq
MIRT2388898	hsa-miR-423-5p	CLIP-seq
MIRT1040636	hsa-miR-4299	CLIP-seq
MIRT1040638	hsa-miR-4417	CLIP-seq
MIRT1040644	hsa-miR-4492	CLIP-seq
MIRT1040646	hsa-miR-4498	CLIP-seq
MIRT1040648	hsa-miR-4656	CLIP-seq
MIRT1040649	hsa-miR-4675	CLIP-seq
MIRT1040652	hsa-miR-4741	CLIP-seq
MIRT2008514	hsa-miR-486-3p	CLIP-seq
MIRT1040656	hsa-miR-541	CLIP-seq
MIRT1040657	hsa-miR-542-3p	CLIP-seq
MIRT1040658	hsa-miR-654-5p	CLIP-seq
MIRT1040659	hsa-miR-762	CLIP-seq
MIRT2450947	hsa-miR-1254	CLIP-seq
MIRT2450948	hsa-miR-3116	CLIP-seq
MIRT2240957	hsa-miR-3120-3p	CLIP-seq
MIRT2450949	hsa-miR-361-3p	CLIP-seq
MIRT2008513	hsa-miR-4690-3p	CLIP-seq
MIRT2450950	hsa-miR-545	CLIP-seq
MIRT1040624	hsa-miR-7	CLIP-seq
MIRT2450947	hsa-miR-1254	CLIP-seq
MIRT2450948	hsa-miR-3116	CLIP-seq
MIRT2240957	hsa-miR-3120-3p	CLIP-seq
MIRT2450950	hsa-miR-545	CLIP-seq
MIRT1040624	hsa-miR-7	CLIP-seq
MIRT1040624	hsa-miR-7	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SSB	Repression	11781104

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	7477378, 9668110, 18192679, 20515468, 21386698, 23532844, 25074808, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	9361024
GO:0006605	Process	Protein targeting	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0006914	Process	Autophagy	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	9361024
GO:0007420	Process	Brain development	NAS	7477378
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008089	Process	Anterograde axonal transport	IEA
GO:0008089	Process	Anterograde axonal transport	ISS
GO:0008090	Process	Retrograde axonal transport	ISS
GO:0008104	Process	Intracellular protein localization	IMP	18922795
GO:0015031	Process	Protein transport	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	9361024
GO:0016234	Component	Inclusion body	IDA	21386698
GO:0017022	Function	Myosin binding	IBA
GO:0017157	Process	Regulation of exocytosis	IEA
GO:0017157	Process	Regulation of exocytosis	ISS
GO:0021549	Process	Cerebellum development	IEA
GO:0021979	Process	Hypothalamus cell differentiation	IEA
GO:0022008	Process	Neurogenesis	IBA
GO:0022008	Process	Neurogenesis	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031587	Process	Positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity	ISS
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	ISS
GO:0032901	Process	Positive regulation of neurotrophin production	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0044325	Function	Transmembrane transporter binding	ISS
GO:0045202	Component	Synapse	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	ISS
GO:0047496	Process	Vesicle transport along microtubule	IBA
GO:0047496	Process	Vesicle transport along microtubule	IEA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IBA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IEA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	ISS
GO:0048311	Process	Mitochondrion distribution	IBA
GO:0048403	Function	Brain-derived neurotrophic factor binding	ISS
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0098793	Component	Presynapse	IEA
GO:1902430	Process	Negative regulation of amyloid-beta formation	ISS
GO:1902513	Process	Regulation of organelle transport along microtubule	IEA
GO:1902513	Process	Regulation of organelle transport along microtubule	ISS
GO:1902857	Process	Positive regulation of non-motile cilium assembly	IEA
GO:1902857	Process	Positive regulation of non-motile cilium assembly	ISS
GO:1904115	Component	Axon cytoplasm	IEA

Other IDs

• MIM: 600947
• HGNC: 4812
• e!Ensembl: ENSG00000173805

Protein

• UniProt ID: P54257
• Protein name: Huntingtin-associated protein 1 (HAP-1) (Neuroan 1)
• Protein function: Originally identified as neuronal protein that specifically associates with HTT/huntingtin and the binding is enhanced by an expanded polyglutamine repeat within HTT possibly affecting HAP1 interaction properties. Both HTT and HAP1 are involved
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04849	HAP1_N	108 → 460	HAP1 N-terminal conserved region	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain. Selectively expressed in neurons.
• Sequence:

  MRPKRLGRCCAGSRLGPGDPAALTCAPSPSASPAPEPSAQPQARGTGQRVGSRATSGSQF
  LSEARTGARPASEAGAKAGARRPSAFSAIQGDVRSMPDNSDAPWTRFVFQGPFGSRATGR
  GTGKAAGIWKTPAAYVGRRPGVSGPERAAFIRELEEALCPNLPPPVKKITQEDVKVMLYL
  LEELLPPVWESVTYGMVLQRERDLNTAARIGQSLVKQNSVLMEENSKLEALLGSAKEEIL
  YLRHQVNLRDELLQLYSDSDEEDEDEEEEEEEKEAEEEQEEEEAEEDLQCAHPCDAPKLI
  SQEALLHQHHCPQLEALQEKLRLLEEENHQLREEASQLDTLEDEEQMLILECVEQFSEAS
  QQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQM
  QLQEESVWVGSQLQDLREKYMDCGGMLIEMQEEVKTLRQQPPVSTGSATHYPYSVPLETL
  PGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQVRGFEAEE
  GLMLAADIMRGEDFTPAEEFVPQEELGAAKKVPAEEGVMEEAELVSEETEGWEEVELELD
  EATRMNVVTSALEASGLGPSHLDMNYVLQQLANWQDAHYRRQLRWKMLQKGECPHGALPA
  ASRTSCRSSCR

• Sequence length: 671

Pathways

KEGG:

GABAergic synapse
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HAP1-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPECIFIC LANGUAGE IMPAIRMENT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30819925, 31491643		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30819925, 31491643		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	31445164		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	33948580	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21463987, 9649566		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31959860	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21463987, 9649566		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10576767		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	24831687	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	26732589		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23440330, 25446120		★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	33948580	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	27984179		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10362100		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19282111, 25081373		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20129380, 27417585		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	25932641	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	26732589		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30819925, 31491643		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28053321, 30562605		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	28053321	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31843818		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10807540, 20129380		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10807540, 20129380, 28351002		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10807540, 18989534, 20129380		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21334452	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	28137862		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	20862287		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17318641, 21331051		★☆☆☆☆ Found in Text Mining only
Familial aplasia of the vermis	Cerebellar vermis agenesis	BEFREE	23532844		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	9657855		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10362100		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31843818		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	16926287		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	16926287	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	16926287		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15629196, 18192679, 19996106, 20512606, 21985783, 22698993, 22720673, 23440330, 27984179, 28259758, 30367943, 31445164, 7477378, 8643490, 8867730, 9599014, 9657855, 9668110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	LHGDN	18192679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	22720673	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	20129380, 28351002		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30084918		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	10807540		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	10576767		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	10807540, 20129380, 28351002		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIb	Hyperlipoproteinemia	BEFREE	10807540		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	16143024		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IV	Hyperlipoproteinemia	BEFREE	10807540		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemias	Hyperlipoproteinemia	BEFREE	28351002		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18235092, 29036458, 30084918, 31201268		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30084918		★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	21228751, 23807322		★☆☆☆☆ Found in Text Mining only
LIPOPROTEIN GLOMERULOPATHY	Lipoprotein Glomerulopathy	BEFREE	17593519		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19282111	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19282111	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23440330, 25446120		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19282111, 25081373		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30560333, 31590960		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10362100		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23440330		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31062249		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24147013		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	8643490		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28808015		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23440330		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	17593519		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27984179, 30367943		★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	15277400		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30289597		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30560333, 31590960		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30560333	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31590960		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	9657855		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31382162		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29096834		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	9657855		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	18671305		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	19251943		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26769152		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	17868456		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	17672902		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35459137	Associate	★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition Of Great Vessels	BEFREE	18989534		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	37725244	Associate	★☆☆☆☆ Found in Text Mining only