Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8999
Gene name	Cyclin dependent kinase like 2
Gene symbol	CDKL2
Synonyms (NCBI Gene)	KKIAMREP56
Chromosome	4
Chromosome location	4q21.1
Summary	This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus. [provided by RefSeq, Jul 2008]

Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028804	hsa-miR-26b-5p	Microarray	19088304
MIRT625368	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625367	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625366	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625365	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625364	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625363	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625362	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT625361	hsa-miR-6750-3p	HITS-CLIP	23824327
MIRT625360	hsa-miR-4719	HITS-CLIP	23824327
MIRT444678	hsa-miR-1243	PAR-CLIP	22100165
MIRT444677	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT444676	hsa-miR-181a-2-3p	PAR-CLIP	22100165
MIRT444675	hsa-miR-1273g-3p	PAR-CLIP	22100165
MIRT444674	hsa-miR-4635	PAR-CLIP	22100165
MIRT444673	hsa-miR-190a-5p	PAR-CLIP	22100165
MIRT444672	hsa-miR-190b	PAR-CLIP	22100165
MIRT444671	hsa-miR-3201	PAR-CLIP	22100165
MIRT444669	hsa-miR-4791	PAR-CLIP	22100165
MIRT444670	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT444668	hsa-miR-6509-3p	PAR-CLIP	22100165
MIRT444667	hsa-miR-4436b-5p	PAR-CLIP	22100165
MIRT444666	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT625368	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625367	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625366	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625365	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625364	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625363	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625362	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT625361	hsa-miR-6750-3p	HITS-CLIP	23824327
MIRT625360	hsa-miR-4719	HITS-CLIP	23824327
MIRT444678	hsa-miR-1243	PAR-CLIP	22100165
MIRT444677	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT444676	hsa-miR-181a-2-3p	PAR-CLIP	22100165
MIRT444675	hsa-miR-1273g-3p	PAR-CLIP	22100165
MIRT444674	hsa-miR-4635	PAR-CLIP	22100165
MIRT444673	hsa-miR-190a-5p	PAR-CLIP	22100165
MIRT444672	hsa-miR-190b	PAR-CLIP	22100165
MIRT444671	hsa-miR-3201	PAR-CLIP	22100165
MIRT444669	hsa-miR-4791	PAR-CLIP	22100165
MIRT444670	hsa-miR-431-5p	PAR-CLIP	22100165
MIRT444668	hsa-miR-6509-3p	PAR-CLIP	22100165
MIRT444667	hsa-miR-4436b-5p	PAR-CLIP	22100165
MIRT444666	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT881597	hsa-miR-1226	CLIP-seq
MIRT881598	hsa-miR-1284	CLIP-seq
MIRT881599	hsa-miR-134	CLIP-seq
MIRT881600	hsa-miR-300	CLIP-seq
MIRT881601	hsa-miR-3118	CLIP-seq
MIRT881602	hsa-miR-3145-3p	CLIP-seq
MIRT881603	hsa-miR-3160-3p	CLIP-seq
MIRT881604	hsa-miR-3164	CLIP-seq
MIRT881605	hsa-miR-3591-5p	CLIP-seq
MIRT881606	hsa-miR-3647-3p	CLIP-seq
MIRT881607	hsa-miR-381	CLIP-seq
MIRT881608	hsa-miR-3938	CLIP-seq
MIRT881609	hsa-miR-4487	CLIP-seq
MIRT881610	hsa-miR-4666-3p	CLIP-seq
MIRT881611	hsa-miR-4733-3p	CLIP-seq
MIRT881612	hsa-miR-558	CLIP-seq
MIRT881613	hsa-miR-584	CLIP-seq
MIRT881614	hsa-miR-648	CLIP-seq
MIRT881599	hsa-miR-134	CLIP-seq
MIRT1961164	hsa-miR-203	CLIP-seq
MIRT881601	hsa-miR-3118	CLIP-seq
MIRT881604	hsa-miR-3164	CLIP-seq
MIRT881605	hsa-miR-3591-5p	CLIP-seq
MIRT881608	hsa-miR-3938	CLIP-seq
MIRT1961165	hsa-miR-4768-5p	CLIP-seq
MIRT881614	hsa-miR-648	CLIP-seq
MIRT2197947	hsa-miR-4279	CLIP-seq
MIRT2197948	hsa-miR-4659a-3p	CLIP-seq
MIRT2197949	hsa-miR-4659b-3p	CLIP-seq
MIRT2197950	hsa-miR-635	CLIP-seq
MIRT2465079	hsa-miR-3914	CLIP-seq
MIRT2465080	hsa-miR-4693-3p	CLIP-seq
MIRT2465081	hsa-miR-4712-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9000130
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0007165	Process	Signal transduction	TAS	9000130
GO:0007548	Process	Sex differentiation	TAS	9000130
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
603442	1782	ENSG00000138769

Q92772

Protein name

Cyclin-dependent kinase-like 2 (EC 2.7.11.22) (Protein kinase p56 KKIAMRE) (Serine/threonine-protein kinase KKIAMRE)

PDB

4AAA , 4BBM , 8S6I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	4 → 287	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis and kidney, and at lower level in brain and lung. {ECO:0000269|PubMed:9000130}.

Sequence

MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRH
ENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSH
NIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYG
KAVDVWAIGCLVTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRL
PEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQEL
QLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKDYKLFKIKGSK
IDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNVSVDHTRNPSVAIPPLTHNLS
AVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSD
DSGADLPQMEHQH

Sequence length

493

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	28984787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33178818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33634306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33110456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11765912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11180095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	9453602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30292871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20208138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29790675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	20484596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	35237874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21124932, 30292871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26902887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21177920	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31270158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29790675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33178818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASCAT_DG	28604728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CDKL2 (cyclin dependent kinase like 2)