PGLYRP1 (peptidoglycan recognition protein 1)

Gene

• Entrez ID: 8993
• Gene name: Peptidoglycan recognition protein 1
• Gene symbol: PGLYRP1
• Synonyms (NCBI Gene): PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
• Chromosome: 19
• Chromosome location: 19q13.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018270	hsa-miR-335-5p	Microarray	18185580
MIRT051104	hsa-miR-16-5p	CLASH	23622248
MIRT1227520	hsa-miR-342-5p	CLIP-seq
MIRT1227521	hsa-miR-3689a-3p	CLIP-seq
MIRT1227522	hsa-miR-3689c	CLIP-seq
MIRT1227523	hsa-miR-4466	CLIP-seq
MIRT1227524	hsa-miR-4651	CLIP-seq
MIRT1227525	hsa-miR-4664-5p	CLIP-seq
MIRT1227526	hsa-miR-4728-5p	CLIP-seq
MIRT1227527	hsa-miR-608	CLIP-seq
MIRT1227528	hsa-miR-675	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	11461926
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	14585845, 25595774, 26654597
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008745	Function	N-acetylmuramoyl-L-alanine amidase activity	IEA
GO:0009253	Process	Peptidoglycan catabolic process	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0016019	Function	Peptidoglycan immune receptor activity	IBA
GO:0016019	Function	Peptidoglycan immune receptor activity	IDA	11461926
GO:0016019	Function	Peptidoglycan immune receptor activity	IEA
GO:0016045	Process	Detection of bacterium	IDA	11461926
GO:0016045	Process	Detection of bacterium	IEA
GO:0030544	Function	Hsp70 protein binding	IDA	14585845
GO:0031640	Process	Killing of cells of another organism	IDA	16354652
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032827	Process	Negative regulation of natural killer cell differentiation involved in immune response	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042834	Function	Peptidoglycan binding	IBA
GO:0042834	Function	Peptidoglycan binding	IDA	11461926, 16354652, 17502600
GO:0042834	Function	Peptidoglycan binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	11461926
GO:0048018	Function	Receptor ligand activity	IDA	25595774
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	11461926, 16354652
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051701	Process	Biological process involved in interaction with host	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	26654597
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	16354652
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 604963
• HGNC: 8904
• e!Ensembl: ENSG00000008438

Protein

• UniProt ID: O75594
• Protein name: Peptidoglycan recognition protein 1 (Peptidoglycan recognition protein short) (PGRP-S)
• Protein function: Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity
• PDB: 1YCK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01510	Amidase_2	51 → 181	N-acetylmuramoyl-L-alanine amidase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils. {ECO:0000269|PubMed:11461926, ECO:0000269|PubMed:9707603}.
• Sequence:

  MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVS
  HTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGH
  LWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPG
  NQLYHLIQNWPHYRSP

• Sequence length: 196

Pathways

Reactome:

Neutrophil degranulation
Antimicrobial peptides

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Juvenile	Juvenile arthritis	Pubtator	34480465	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33565964	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34722779	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15598955, 32240562	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28846062		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	31587460		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34183667	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	37939716	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23840689		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34183667	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37522815	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	15598955	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29774543	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29937377, 30463009, 31404632		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23840689		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28846062		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15598955		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15598955, 32240562	Associate	★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	35329310	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27868339		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32925767	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24838182		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24838182	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18643845		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25221852, 30431075		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	26025919		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	31801935	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	35955827	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23840689		★☆☆☆☆ Found in Text Mining only
Winter Shortland Temple syndrome	Winter shortland temple syndrome	Pubtator	34722779	Associate	★☆☆☆☆ Found in Text Mining only