SELENBP1 (selenium binding protein 1)

Gene

• Entrez ID: 8991
• Gene name: Selenium binding protein 1
• Gene symbol: SELENBP1
• Synonyms (NCBI Gene): EHMTO, HEL-S-134P, LPSB, MTO, SBP56, SP56, hSBP
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a member of the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. The effects of selenium in preventing

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs758495626	C>A,T	Pathogenic, likely-pathogenic	Intron variant, coding sequence variant, missense variant
rs1357490520	C>A,T	Pathogenic	Splice donor variant
rs1553204817	C>A	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1553204840	G>A	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017378	hsa-miR-335-5p	Microarray	18185580
MIRT029152	hsa-miR-26b-5p	Microarray	19088304
MIRT050594	hsa-miR-20a-5p	CLASH	23622248
MIRT049678	hsa-miR-92a-3p	CLASH	23622248
MIRT1334251	hsa-miR-128	CLIP-seq
MIRT1334252	hsa-miR-15a	CLIP-seq
MIRT1334253	hsa-miR-15b	CLIP-seq
MIRT1334254	hsa-miR-16	CLIP-seq
MIRT1334255	hsa-miR-195	CLIP-seq
MIRT1334256	hsa-miR-3064-3p	CLIP-seq
MIRT1334257	hsa-miR-3148	CLIP-seq
MIRT1334258	hsa-miR-335	CLIP-seq
MIRT1334259	hsa-miR-3545-5p	CLIP-seq
MIRT1334260	hsa-miR-3670	CLIP-seq
MIRT1334261	hsa-miR-3688-3p	CLIP-seq
MIRT1334262	hsa-miR-424	CLIP-seq
MIRT1334263	hsa-miR-4317	CLIP-seq
MIRT1334264	hsa-miR-4709-5p	CLIP-seq
MIRT1334265	hsa-miR-4715-3p	CLIP-seq
MIRT1334266	hsa-miR-490-5p	CLIP-seq
MIRT1334267	hsa-miR-497	CLIP-seq
MIRT1334268	hsa-miR-578	CLIP-seq
MIRT1334251	hsa-miR-128	CLIP-seq
MIRT1334252	hsa-miR-15a	CLIP-seq
MIRT1334253	hsa-miR-15b	CLIP-seq
MIRT1334254	hsa-miR-16	CLIP-seq
MIRT1334255	hsa-miR-195	CLIP-seq
MIRT1334257	hsa-miR-3148	CLIP-seq
MIRT1334259	hsa-miR-3545-5p	CLIP-seq
MIRT1334260	hsa-miR-3670	CLIP-seq
MIRT1334261	hsa-miR-3688-3p	CLIP-seq
MIRT1334262	hsa-miR-424	CLIP-seq
MIRT1334264	hsa-miR-4709-5p	CLIP-seq
MIRT1334266	hsa-miR-490-5p	CLIP-seq
MIRT1334267	hsa-miR-497	CLIP-seq
MIRT1334251	hsa-miR-128	CLIP-seq
MIRT2323722	hsa-miR-147	CLIP-seq
MIRT1334252	hsa-miR-15a	CLIP-seq
MIRT1334253	hsa-miR-15b	CLIP-seq
MIRT1334254	hsa-miR-16	CLIP-seq
MIRT1334255	hsa-miR-195	CLIP-seq
MIRT2323723	hsa-miR-2278	CLIP-seq
MIRT1334257	hsa-miR-3148	CLIP-seq
MIRT1334258	hsa-miR-335	CLIP-seq
MIRT2323724	hsa-miR-3616-3p	CLIP-seq
MIRT1334260	hsa-miR-3670	CLIP-seq
MIRT1334261	hsa-miR-3688-3p	CLIP-seq
MIRT2323725	hsa-miR-3911	CLIP-seq
MIRT1334262	hsa-miR-424	CLIP-seq
MIRT2323726	hsa-miR-4453	CLIP-seq
MIRT2323727	hsa-miR-4468	CLIP-seq
MIRT2323728	hsa-miR-4480	CLIP-seq
MIRT2323729	hsa-miR-4536	CLIP-seq
MIRT2323730	hsa-miR-4538	CLIP-seq
MIRT2323731	hsa-miR-4687-3p	CLIP-seq
MIRT2323732	hsa-miR-4721	CLIP-seq
MIRT2323733	hsa-miR-4786-3p	CLIP-seq
MIRT1334267	hsa-miR-497	CLIP-seq
MIRT2323734	hsa-miR-644	CLIP-seq
MIRT2323735	hsa-miR-647	CLIP-seq
MIRT2323722	hsa-miR-147	CLIP-seq
MIRT1334256	hsa-miR-3064-3p	CLIP-seq
MIRT2323725	hsa-miR-3911	CLIP-seq
MIRT2323726	hsa-miR-4453	CLIP-seq
MIRT2323729	hsa-miR-4536	CLIP-seq
MIRT2323730	hsa-miR-4538	CLIP-seq
MIRT2323731	hsa-miR-4687-3p	CLIP-seq
MIRT2323734	hsa-miR-644	CLIP-seq
MIRT2323735	hsa-miR-647	CLIP-seq
MIRT2323722	hsa-miR-147	CLIP-seq
MIRT1334256	hsa-miR-3064-3p	CLIP-seq
MIRT2323725	hsa-miR-3911	CLIP-seq
MIRT2323726	hsa-miR-4453	CLIP-seq
MIRT2323728	hsa-miR-4480	CLIP-seq
MIRT2323729	hsa-miR-4536	CLIP-seq
MIRT2323730	hsa-miR-4538	CLIP-seq
MIRT2323731	hsa-miR-4687-3p	CLIP-seq
MIRT2323734	hsa-miR-644	CLIP-seq
MIRT2323735	hsa-miR-647	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	16189514, 19118533, 29892012, 31515488, 32296183
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0008430	Function	Selenium binding	IEA
GO:0008430	Function	Selenium binding	TAS	9027582
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0018549	Function	Methanethiol oxidase activity	IEA
GO:0018549	Function	Methanethiol oxidase activity	IMP	29255262
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 604188
• HGNC: 10719
• e!Ensembl: ENSG00000143416

Protein

• UniProt ID: Q13228
• Protein name: Methanethiol oxidase (MTO) (EC 1.8.3.4) (56 kDa selenium-binding protein) (SBP56) (SP56) (Selenium-binding protein 1)
• Protein function: Catalyzes the oxidation of methanethiol, an organosulfur compound known to be produced in substantial amounts by gut bacteria (PubMed:29255262). Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytopla
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05694	SBP56	6 → 472	56kDa selenium binding protein (SBP56)	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two
• Sequence:

  MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVI
  HRLPMPNLKDELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHK
  VIEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERP
  GGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQ
  TLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKG
  WLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGP
  VQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIRE
  GSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI

• Sequence length: 472

Pathways

KEGG:

Sulfur metabolism
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Extra oral halitosis	Likely pathogenic	rs1553204817, rs1553204840, rs758495626	RCV000664061 RCV000664063 RCV000664052	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Extraoral halitosis due to methanethiol oxidase deficiency	Likely pathogenic; Pathogenic	rs1553204817, rs1553204840, rs758495626, rs1357490520	RCV000710010 RCV000710013 RCV000710012 RCV000710011	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELENBP1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	30531323, 31058800		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30732890, 31415308		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	14991897, 15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20332323		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	20332323		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14991897, 30002193		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	14991897, 15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	14991897, 15378696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	14991897, 15378696		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30577465		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28505062		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28505062		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29156411		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24764015	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29144802		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28236285		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	30905258		★☆☆☆☆ Found in Text Mining only
Autosomal recessive extra-oral halitosis	Extra-Oral Halitosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20332323		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20332323	Inhibit	★☆☆☆☆ Found in Text Mining only
Bartter Disease	Bartter syndrome	BEFREE	24356540		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	14991897	Inhibit	★☆☆☆☆ Found in Text Mining only
Bradycardia	Bradycardia	Pubtator	31450690	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	33603109	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23704933, 28362679		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23704933	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	23977169	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21143902, 36253721	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32443734, 34493740	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29535818, 30002193		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25227434	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26956891	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	14991897, 15378696		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	14991897, 15378696		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16380993, 18272210		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27722961, 27870655, 27881394, 28199497, 28234673, 28253218, 28350621, 28422891, 28800042, 28886599, 29049227, 29144802, 29351490, 29592967, 30111315, 30246473, 30715100, 30764511, 30899285, 30950973, 31116159, 31188164, 31288541, 31335511, 31790053		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31450690		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	30540658		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27906836, 28030430, 28134031, 28169880, 28697009, 28832365, 28952798, 29210861, 30531323, 30540658, 30624986, 31039789, 31058800, 31246895, 31335511, 31415308, 31471435, 31541606, 31714348, 31834125		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	30128642, 31759528		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	27028369		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31014164		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27924804, 29045334, 29046987, 29320555, 30234771, 30624364, 30817460, 30817462, 31147751, 31315567, 31392910, 31598911		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18435490, 19924303, 24737289		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18435490		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16645984, 18435490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	18435490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18435490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36253721	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	27870655, 28343761, 30950980, 30958967, 31584516		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25227434		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10334798, 30325341		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10334798, 30325341, 31045965		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10334798, 29210861, 29846329, 30325341, 31116159, 31335511		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31019652		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28505062, 28642211		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18972257, 25899017, 26200036, 28009704, 28029211, 28374214, 28806350, 28858983, 28957848, 29137464, 30624364, 30640884, 30715100, 30817462, 31045965, 31205199, 31356179, 31840813		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18972257, 25899017, 26200036, 28009704, 28029211, 28374214, 28512184, 28800042, 28806350, 28832365, 28858983, 28957848, 29137464, 30308135, 30369572, 30371182, 30624364, 30640884, 30715100, 30817462, 31045965, 31205199, 31356179, 31451203, 31840813		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30882596, 31433534		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16572495, 20051912, 27870655, 28387058, 28677941, 29369147, 29557199, 29592967, 30026549, 30308135, 30624364, 30640884, 30817462, 30830724, 30913011, 31612146, 31711859, 31760494		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	29794815		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18849600, 27631001, 29063128, 30640884, 31711859		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30971163		★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	10642347		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30971163		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	31415308		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	30905258		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30786773		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30882596		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18568692, 28534704, 29065098, 29846324		★☆☆☆☆ Found in Text Mining only
EXTRAORAL HALITOSIS DUE TO METHANETHIOL OXIDASE DEFICIENCY	Extra-Oral Halitosis	UNIPROT_DG	29255262		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EXTRAORAL HALITOSIS DUE TO METHANETHIOL OXIDASE DEFICIENCY	Extra-Oral Halitosis	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fatty Liver	Fatty Liver	BEFREE	17805459, 31511022		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28990066		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	28253217		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29331952, 29879162		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	39488256	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	28934431		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	28934431		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27583873		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27583873	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27870655, 28343761, 30950980, 30958967, 31584516		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15378696, 19424620		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28444336, 30325241		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28444336, 30325241		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	30958034		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10334798, 17971240, 19304780, 20852445, 22304237, 23102448, 23591986, 25304467, 25695618, 27654328, 27708284, 27712964, 27808564, 27846042, 27977472, 28009704, 28060189, 28129402, 28169882, 28234673, 28253218, 28253219, 28267464, 28306636, 28318434, 28335671, 28343761, 28387058, 28391629, 28428231, 28438199, 28441696, 28444926, 28485264, 28512184, 28545582, 28633388, 28659507, 28746172, 28817494, 28928111, 28957848, 29049227, 29085308, 29210861, 29331891, 29335612, 29390287, 29398408, 29553846, 29601413, 29604170, 30063644, 30128642, 30247506, 30285504, 30300252, 30308593, 30308598, 30325241, 30347395, 30369572, 30398601, 30444838, 30520848, 30572143, 30622317, 30624364, 30624370, 30631132, 30634050, 30640883, 30715100, 30742871, 30766489, 30771749, 30786773, 30801386, 30817448, 30817449, 30817453, 30817462, 30835575, 30938496, 30950973, 30964439, 31038015, 31045965, 31083159, 31116159, 31133682, 31157741, 31162282, 31166251, 31190479, 31205199, 31268917, 31288541, 31318156, 31356404, 31361065, 31386636, 31392910, 31463701, 31471435, 31534974, 31542950, 31633582, 31672364, 31714348, 31790053, 31812956, 31826379, 31840813		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31626136		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	29421796		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	27633894, 29376760		★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	19304780		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31450690	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	36253721	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30371241		★☆☆☆☆ Found in Text Mining only
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	CTD_human_DG	29255262		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	27028369		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33011346	Associate	★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	10642347		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30640884		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27722961, 28665768, 29210843, 29633937		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31014164		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28650917, 29413668, 29465711, 29521854, 29634639, 30393492, 31205199		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22512980, 30034941		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	27128963, 29879162		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	14991897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	30002193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26956891	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27583873		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23704933, 28362679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28157813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	14991897		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30002193		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16380993, 18272210		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	16380993, 18272210		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15378696, 19424620		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23483240, 27583873, 30400135		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	28505062		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29535818		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28505062, 28642211		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	31471435		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	39488256	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21493754, 28493030, 28740055, 29024310, 29144802, 29320555, 29345215, 29907356, 30157802, 30273286		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30052724		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26593911	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	23977169	Associate	★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	29796220		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28052880, 31335511, 31450690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	31450690	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	31450690	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31759528		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27583873		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27583873	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16380993, 18272210, 25227434, 27583873, 28938569, 29535818, 30002193		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	31089183		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30469030, 30991275		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	18163446		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28633388, 29866072, 30321217, 31157741, 31361065		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	37606338	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	27965399		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16380993, 18272210		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16380993		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	16380993, 18272210		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36430645	Associate	★☆☆☆☆ Found in Text Mining only
Pelger-Huet Anomaly	Pelger-Huet Anomaly	BEFREE	30690759		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31549149		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29930023, 30845872, 31335806		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	30845872		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	10334798		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30958034		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31756119		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	27965399		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21143902	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25871394, 25993660, 26847995, 32511787	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	30092825	Associate	★☆☆☆☆ Found in Text Mining only
Psychosis, Brief Reactive	Psychosis	CTD_human_DG	18163446		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	18163446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	CTD_human_DG	18163446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	28157813		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25227434		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30048993		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	CTD_human_DG	18163446		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16223876, 18163446, 19596560, 20615253, 29577944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	16223876, 18163446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophreniform Disorders	Schizophreniform Disorders	CTD_human_DG	18163446		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27906839, 27906840		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27583873	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27583873		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28891162		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17805459, 31511022		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15378696, 19424620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30048226		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16788983	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	31541606		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	31541606		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31918717	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31083159		★☆☆☆☆ Found in Text Mining only