TRPA1 (transient receptor potential cation channel subfamily A member 1)

Gene

• Entrez ID: 8989
• Gene name: Transient receptor potential cation channel subfamily A member 1
• Gene symbol: TRPA1
• Synonyms (NCBI Gene): ANKTM1, FEPS, FEPS1, p120
• Chromosome: 8
• Chromosome location: 8q21.11
• Summary: The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in si

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023904	hsa-miR-1-3p	Microarray	18668037
MIRT025846	hsa-miR-7-5p	Microarray	17612493
MIRT1457191	hsa-miR-1257	CLIP-seq
MIRT1457192	hsa-miR-1293	CLIP-seq
MIRT1457193	hsa-miR-1324	CLIP-seq
MIRT1457194	hsa-miR-1825	CLIP-seq
MIRT1457195	hsa-miR-199a-5p	CLIP-seq
MIRT1457196	hsa-miR-199b-5p	CLIP-seq
MIRT1457197	hsa-miR-30a	CLIP-seq
MIRT1457198	hsa-miR-30b	CLIP-seq
MIRT1457199	hsa-miR-30c	CLIP-seq
MIRT1457200	hsa-miR-30d	CLIP-seq
MIRT1457201	hsa-miR-30e	CLIP-seq
MIRT1457202	hsa-miR-3134	CLIP-seq
MIRT1457203	hsa-miR-3136-5p	CLIP-seq
MIRT1457204	hsa-miR-409-3p	CLIP-seq
MIRT1457205	hsa-miR-4276	CLIP-seq
MIRT1457206	hsa-miR-4302	CLIP-seq
MIRT1457207	hsa-miR-4434	CLIP-seq
MIRT1457208	hsa-miR-4439	CLIP-seq
MIRT1457209	hsa-miR-4483	CLIP-seq
MIRT1457210	hsa-miR-4513	CLIP-seq
MIRT1457211	hsa-miR-4516	CLIP-seq
MIRT1457212	hsa-miR-4531	CLIP-seq
MIRT1457213	hsa-miR-4534	CLIP-seq
MIRT1457214	hsa-miR-541	CLIP-seq
MIRT1457215	hsa-miR-643	CLIP-seq
MIRT1457216	hsa-miR-654-5p	CLIP-seq
MIRT1457217	hsa-miR-943	CLIP-seq
MIRT2137078	hsa-miR-3151	CLIP-seq
MIRT2137079	hsa-miR-3154	CLIP-seq
MIRT2137080	hsa-miR-4283	CLIP-seq
MIRT2137081	hsa-miR-4489	CLIP-seq
MIRT2137082	hsa-miR-451b	CLIP-seq
MIRT2137083	hsa-miR-664	CLIP-seq
MIRT2357849	hsa-miR-1197	CLIP-seq
MIRT2357850	hsa-miR-3150b-3p	CLIP-seq
MIRT2137078	hsa-miR-3151	CLIP-seq
MIRT2137079	hsa-miR-3154	CLIP-seq
MIRT2137080	hsa-miR-4283	CLIP-seq
MIRT2357851	hsa-miR-4420	CLIP-seq
MIRT2357852	hsa-miR-4457	CLIP-seq
MIRT2137081	hsa-miR-4489	CLIP-seq
MIRT2137082	hsa-miR-451b	CLIP-seq
MIRT2357853	hsa-miR-4639-3p	CLIP-seq
MIRT2357854	hsa-miR-4649-3p	CLIP-seq
MIRT2357855	hsa-miR-4689	CLIP-seq
MIRT2357856	hsa-miR-4731-3p	CLIP-seq
MIRT2357857	hsa-miR-4778-3p	CLIP-seq
MIRT2357858	hsa-miR-4784	CLIP-seq
MIRT2357859	hsa-miR-4789-3p	CLIP-seq
MIRT2357860	hsa-miR-4801	CLIP-seq
MIRT2357861	hsa-miR-4803	CLIP-seq
MIRT2357862	hsa-miR-493	CLIP-seq
MIRT2357863	hsa-miR-642b	CLIP-seq
MIRT2137083	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003008	Process	System process	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005245	Function	Voltage-gated calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	20547126, 25855297
GO:0005886	Component	Plasma membrane	TAS	10066796
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS	10066796
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	30990108
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS	25605129
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	IMP	20547126
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0014832	Process	Urinary bladder smooth muscle contraction	IEA
GO:0015267	Function	Channel activity	IEA
GO:0015267	Function	Channel activity	TAS	10066796
GO:0015278	Function	Intracellularly gated calcium channel activity	IBA
GO:0015278	Function	Intracellularly gated calcium channel activity	IDA	20547126
GO:0015278	Function	Intracellularly gated calcium channel activity	IMP	25855297
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019233	Process	Sensory perception of pain	IMP	20547126
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0022836	Function	Gated channel activity	IEA
GO:0030424	Component	Axon	IEA
GO:0032421	Component	Stereocilium bundle	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034605	Process	Cellular response to heat	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042802	Function	Identical protein binding	IPI	25855297
GO:0048265	Process	Response to pain	IEA
GO:0050955	Process	Thermoception	IBA
GO:0050955	Process	Thermoception	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0050968	Process	Detection of chemical stimulus involved in sensory perception of pain	IBA
GO:0050968	Process	Detection of chemical stimulus involved in sensory perception of pain	IEA
GO:0050974	Process	Detection of mechanical stimulus involved in sensory perception	IEA
GO:0051289	Process	Protein homotetramerization	IDA	25855297
GO:0055085	Process	Transmembrane transport	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	30990108
GO:0070417	Process	Cellular response to cold	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IMP	20547126, 25855297
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0071240	Process	Cellular response to food	IEA
GO:0071240	Process	Cellular response to food	ISS	25605129
GO:0071244	Process	Cellular response to carbon dioxide	IEA
GO:0071313	Process	Cellular response to caffeine	IEA
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:0097553	Process	Calcium ion transmembrane import into cytosol	IBA
GO:0097553	Process	Calcium ion transmembrane import into cytosol	IEA
GO:0097604	Function	Temperature-gated cation channel activity	IDA	20547126
GO:0098908	Process	Regulation of neuronal action potential	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1903522	Process	Regulation of blood circulation	IEA
GO:1903793	Process	Positive regulation of monoatomic anion transport	IEA
GO:1990760	Function	Osmolarity-sensing monoatomic cation channel activity	IEA

Other IDs

• MIM: 604775
• HGNC: 497
• e!Ensembl: ENSG00000104321

Protein

• UniProt ID: O75762
• Protein name: Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation-sensitive protein p120) (p120) (Wasabi receptor)
• Protein function: Ligand-activated Ca(2+)-permeable, nonselective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function (PubMed:17259981, PubMed:21195050, PubMed:218739
• PDB: 3J9P, 6HC8, 6PQO, 6PQP, 6PQQ, 6V9V, 6V9W, 6V9X, 6V9Y, 6WJ5, 6X2J, 7JUP, 7OR0, 7OR1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00023	Ank	97 → 129	Ankyrin repeat	Repeat
  PF00023	Ank	240 → 269	Ankyrin repeat	Repeat
  PF00023	Ank	341 → 373	Ankyrin repeat	Repeat
  PF00023	Ank	412 → 442	Ankyrin repeat	Repeat
  PF00023	Ank	481 → 511	Ankyrin repeat	Repeat
  PF00023	Ank	547 → 579	Ankyrin repeat	Repeat
  PF00520	Ion_trans	721 → 972	Ion transport protein	Family

• Sequence:

  MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
  DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
  GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
  LQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
  TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
  IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
  LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
  CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
  HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
  TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
  RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
  KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
  MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
  SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
  FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
  PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
  VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
  CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
  DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

• Sequence length: 1119

Pathways

KEGG:

Inflammatory mediator regulation of TRP channels

Reactome:

TRP channels

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Familial episodic pain syndrome with predominantly upper body involvement	Pathogenic	rs398123010	RCV000032802	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN FASCICULATION-CRAMP SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COUGH	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRAMP-FASCICULATION SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPISODIC PAIN SYNDROME, FAMILIAL, 1	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRPA1-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER, OVERACTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	29990841		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29038531		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	29081531, 31654757		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	29620434	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29620434		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31680989		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22211974		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	37373205	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CTD_human_DG	19458046		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26039217, 27758864, 27779810, 28076424, 36847817, 37386145	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	28076424, 28102732, 30440113, 30716586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	31680989		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Stimulate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	29081531, 31654757		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38564162	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	19458046		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	24037916, 29805077		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33479347	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	37373205	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	27779810		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21763243		★☆☆☆☆ Found in Text Mining only
Congenital Pain Insensitivity	Congenital Pain Insensitivity	BEFREE	24813307		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30707612		★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	28478727	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	31228448		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26708285		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	26039217, 35509099, 37386145	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniosynostosis	Craniosynostosis	BEFREE	29476616		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31892361	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27281024		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	28446032		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	29759134		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28963585		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29081531, 31228448		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	27566753, 28240277		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28614190		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20004676		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20004676		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30807826		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	30807826		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	31219946		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	36430572	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28614190		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	26039217	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25029427	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28478727	Associate	★☆☆☆☆ Found in Text Mining only
EPISODIC PAIN SYNDROME, FAMILIAL, 1	Episodic pain syndrome	UNIPROT_DG	20547126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPISODIC PAIN SYNDROME, FAMILIAL, 1	Episodic pain syndrome	ORPHANET_DG	20547126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPISODIC PAIN SYNDROME, FAMILIAL, 1	Episodic pain syndrome	GENOMICS_ENGLAND_DG	21468319, 28436534		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPISODIC PAIN SYNDROME, FAMILIAL, 1	Episodic pain syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial episodic pain syndrome with predominantly upper body involvement	Episodic Pain Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Foley-Denny-Brown Syndrome	Benign fasciculation-cramp syndrome	BEFREE	28436534		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31519574		★☆☆☆☆ Found in Text Mining only
Gingival Hypertrophy	Gingival Hypertrophy	BEFREE	28571526		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30590317		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35982414	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30590317		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	34488389	Associate	★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	21468319, 26358221	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	28385191		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31680989		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	31184584		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	31327223		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29149168, 30717786		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29149168	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29081531, 31228448		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31327223		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33530940	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37511605	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24037916, 29805077		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28096238, 31288452		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23219522, 24037916, 26708603, 28096238, 29805077		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28963585		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30587572		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	26639834, 28622417, 28884307, 29719223, 30784351, 30841847, 31835593		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	29719223		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31280200		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26708285		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29476616		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32986378	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	34440820	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23219522, 24084605, 29805077		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	36098890	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19507192, 24975826, 30513192		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	28436534	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	22740698, 28332600, 28894590, 29274353		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Dysphagia	Oropharyngeal Dysphagia	BEFREE	26530852		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	39313491	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33479347, 36012311	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28848196		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28614189, 30510606		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	35806193, 38564162	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30510606		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28848196		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28096238, 31288452		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28277613	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	33183050, 37386145	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	29550417, 31111624		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28076424	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30717786		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29698501		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22182671		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	33076385	Associate	★☆☆☆☆ Found in Text Mining only
Sensory Disorders	Sensory Disorders	BEFREE	19033673		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26074006		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23219522		★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	24813307		★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	BEFREE	28891864		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35163843	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31553934		★☆☆☆☆ Found in Text Mining only