Gene Gene information from NCBI Gene database.
Entrez ID 89876
Gene name Cilia and flagella associated protein 91
Gene symbol CFAP91
Synonyms (NCBI Gene)
AAT1AAT1alphaC3orf15CaM-IP2MAATS1SPATA26SPGF51
Chromosome 3
Chromosome location 3q13.33
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs147597066 G>A,C Pathogenic Splice donor variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0001536 Component Radial spoke stalk ISS
GO:0003341 Process Cilium movement ISS
GO:0005515 Function Protein binding IPI 12223483, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609910 24010 ENSG00000183833
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z4T9
Protein name Cilia- and flagella-associated protein 91 (CFAP91) (AMY-1-associating protein expressed in testis 1) (AAT-1) (MYCBP/AMY-1-associated testis-expressed protein 1) (Protein MAATS1)
Protein function Involved in sperm flagellum axonemal organization and function (PubMed:12223483, PubMed:32161152). May regulate cilium motility through its role in the assembly of the axonemal radial spokes (By similarity). {ECO:0000250|UniProtKB:A8IH47, ECO:00
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14738 CFAP91 191 343 Cilia- and flagella-associated protein 91 Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 1]: Strongly expressed in the liver.; TISSUE SPECIFICITY: [Isoform 7]: Widely expressed, but strongly expressed in all spermatogenesis-related tissues, including the testis, the epithelium of cauda and the corpus epididymis, a
Sequence
MSHAVTIEEPQAQPQVSQTRYRERSRAGSHISSNRAYDFLYDPLFIVSSEKDHTQANIQA
TLIRSRLRKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQLTT
TDASFQMPKEVYEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAVSKAEPYTFPPTSTKH
LSIPSKSTVGTQTDYRDADVQTDPYSAEYVVCQDSIPELLTLATLTWGRGLPAGQAEVEM
IERAREKRAWEASLPALSDTSQFEKRRKMMNEMERKEWAFREQEIEKLQEIRLEVLKELL
RKREENQNEVNMKHLNARWSKLQEGKEAKMAKIQRTHVSTIRK
LVGKRKNIEGKLERRNI
IKDYSDYASQVYGPLSRLGCFPDNNSEDFVVKNYYLNTYEGLVELESCLPDFVTQPQIRA
PKPKVITTKAGFLKRAARLDYELAEVHKALLDKKNKVLEVKKPPRFLQRNPIPQPRLPTP
TLEMTSNEEEEMEMAVIYLQKLLRGRVVQNMMFEGKEKRLELIQELRTCHALQEDEKLVK
KAEKQVTLALQRQRNLHEHKVSLVENHLAGLEGRALADMFDFLSKELVRLQEERRIHAFV
MLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANTAE
EQARAEIEKMAEKINDIAYEMESRRTYLQSEEIVAELVYSFLIPEVQKYFVKEKVRNAQR
KHILAAHQIIHSYTESMVQKKLTEGEQDEASNAAMLLEKETQNENNS
Sequence length 767
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Male infertility with teratozoospermia due to single gene mutation Pathogenic rs147597066 RCV001003477
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spermatogenic failure 51 Likely pathogenic; Pathogenic rs757703206, rs147597066 RCV003148490
RCV001290736
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CFAP91-related condition Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aortic Aneurysm Aortic Aneurysm BEFREE 11369687
★☆☆☆☆
Found in Text Mining only
Congenital aneurysm of ascending aorta Congenital Aneurysm Of Ascending Aorta BEFREE 11369687, 15529063
★☆☆☆☆
Found in Text Mining only