AQP10 (aquaporin 10)

Gene

• Entrez ID: 89872
• Gene name: Aquaporin 10
• Gene symbol: AQP10
• Synonyms (NCBI Gene): AQPA_HUMAN
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-se

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018828	hsa-miR-335-5p	Microarray	18185580
MIRT791350	hsa-miR-1253	CLIP-seq
MIRT791351	hsa-miR-1255a	CLIP-seq
MIRT791352	hsa-miR-1255b	CLIP-seq
MIRT791353	hsa-miR-149	CLIP-seq
MIRT791354	hsa-miR-331-3p	CLIP-seq
MIRT791355	hsa-miR-3616-5p	CLIP-seq
MIRT791356	hsa-miR-3647-5p	CLIP-seq
MIRT791357	hsa-miR-4292	CLIP-seq
MIRT791358	hsa-miR-4313	CLIP-seq
MIRT791359	hsa-miR-4685-5p	CLIP-seq
MIRT791360	hsa-miR-4765	CLIP-seq
MIRT791361	hsa-miR-4779	CLIP-seq
MIRT791362	hsa-miR-4795-5p	CLIP-seq
MIRT791363	hsa-miR-573	CLIP-seq
MIRT791364	hsa-miR-765	CLIP-seq
MIRT791350	hsa-miR-1253	CLIP-seq
MIRT791351	hsa-miR-1255a	CLIP-seq
MIRT791352	hsa-miR-1255b	CLIP-seq
MIRT791361	hsa-miR-4779	CLIP-seq
MIRT791364	hsa-miR-765	CLIP-seq
MIRT2675195	hsa-miR-1915	CLIP-seq
MIRT2675196	hsa-miR-2355-5p	CLIP-seq
MIRT2675197	hsa-miR-296-3p	CLIP-seq
MIRT2675198	hsa-miR-3616-3p	CLIP-seq
MIRT2675199	hsa-miR-4436b-3p	CLIP-seq
MIRT2675200	hsa-miR-4802-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005811	Component	Lipid droplet	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	30420639
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006833	Process	Water transport	IBA
GO:0006833	Process	Water transport	IDA	30420639
GO:0006833	Process	Water transport	IEA
GO:0009636	Process	Response to toxic substance	IDA	17575980
GO:0015204	Function	Urea transmembrane transporter activity	IBA
GO:0015250	Function	Water channel activity	IBA
GO:0015250	Function	Water channel activity	IDA	12084581, 30420639
GO:0015250	Function	Water channel activity	IEA
GO:0015254	Function	Glycerol channel activity	IBA
GO:0015254	Function	Glycerol channel activity	IDA	12084581, 30420639
GO:0015254	Function	Glycerol channel activity	IEA
GO:0015267	Function	Channel activity	IEA
GO:0015793	Process	Glycerol transmembrane transport	IBA
GO:0015793	Process	Glycerol transmembrane transport	IDA	30420639
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	15221416
GO:0016324	Component	Apical plasma membrane	IEA
GO:0051289	Process	Protein homotetramerization	IDA	30420639
GO:0055085	Process	Transmembrane transport	IEA
GO:0071918	Process	Urea transmembrane transport	IEA

Other IDs

• MIM: 606578
• HGNC: 16029
• e!Ensembl: ENSG00000143595

Protein

• UniProt ID: Q96PS8
• Protein name: Aquaporin-10 (AQP-10) (Aquaglyceroporin-10) (Small intestine aquaporin)
• Protein function: Aquaglyceroporins form homotetrameric transmembrane channels, with each monomer independently mediating glycerol and water transport across the plasma membrane along their osmotic gradient (PubMed:11573934, PubMed:12084581, PubMed:21733844, PubM
• PDB: 6F7H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00230	MIP	15 → 260	Major intrinsic protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level) (PubMed:15221416, PubMed:23382902). Expressed in duodenum and jejunum. Highest expres
• Sequence:

  MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFL
  AGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYV
  LYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDR
  RNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNG
  WWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
  L

• Sequence length: 301

Pathways

Reactome:

Passive transport by Aquaporins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	30863160		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35245343	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36254092	Associate	★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	29607712		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	25725905	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30863160		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23382902, 29132311	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	29607712		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29472315	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29678898	Associate	★☆☆☆☆ Found in Text Mining only