Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8986
Gene name	Ribosomal protein S6 kinase A4
Gene symbol	RPS6KA4
Synonyms (NCBI Gene)	MSK2RSK-BS6K-alpha-4
Chromosome	11
Chromosome location	11q13.1
Summary	This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and ATF1. The encoded protein can also pho

266

Show/Hide all (266)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022283	hsa-miR-124-3p	Microarray	18668037
MIRT468925	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT468926	hsa-miR-520f-3p	PAR-CLIP	23592263
MIRT468924	hsa-miR-6750-3p	PAR-CLIP	23592263
MIRT468923	hsa-miR-6085	PAR-CLIP	23592263
MIRT468922	hsa-miR-6813-5p	PAR-CLIP	23592263
MIRT468921	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT468920	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT468918	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT468919	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT468917	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT060316	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT060312	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT468916	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT468915	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT468914	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT468913	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT468912	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT468911	hsa-miR-4283	PAR-CLIP	23592263
MIRT468910	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT468909	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT468908	hsa-miR-5698	PAR-CLIP	23592263
MIRT468907	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT468906	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT468904	hsa-miR-4525	PAR-CLIP	23592263
MIRT468905	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT468903	hsa-miR-4447	PAR-CLIP	23592263
MIRT468902	hsa-miR-4472	PAR-CLIP	23592263
MIRT468901	hsa-miR-1275	PAR-CLIP	23592263
MIRT468900	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT468921	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT468921	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT468925	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT468926	hsa-miR-520f-3p	PAR-CLIP	23592263
MIRT468924	hsa-miR-6750-3p	PAR-CLIP	23592263
MIRT468923	hsa-miR-6085	PAR-CLIP	23592263
MIRT468922	hsa-miR-6813-5p	PAR-CLIP	23592263
MIRT468921	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT468920	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT468918	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT468919	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT468917	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT060316	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT060312	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT468916	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT468915	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT468914	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT468913	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT468912	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT468911	hsa-miR-4283	PAR-CLIP	23592263
MIRT468910	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT468909	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT468908	hsa-miR-5698	PAR-CLIP	23592263
MIRT468907	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT468906	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT468904	hsa-miR-4525	PAR-CLIP	23592263
MIRT468905	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT468903	hsa-miR-4447	PAR-CLIP	23592263
MIRT468902	hsa-miR-4472	PAR-CLIP	23592263
MIRT468901	hsa-miR-1275	PAR-CLIP	23592263
MIRT468900	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT1318300	hsa-miR-106a	CLIP-seq
MIRT1318301	hsa-miR-106b	CLIP-seq
MIRT1318302	hsa-miR-1324	CLIP-seq
MIRT1318303	hsa-miR-142-5p	CLIP-seq
MIRT1318304	hsa-miR-17	CLIP-seq
MIRT1318305	hsa-miR-20a	CLIP-seq
MIRT1318306	hsa-miR-20b	CLIP-seq
MIRT1318307	hsa-miR-25	CLIP-seq
MIRT1318308	hsa-miR-302f	CLIP-seq
MIRT1318309	hsa-miR-3165	CLIP-seq
MIRT1318310	hsa-miR-32	CLIP-seq
MIRT1318311	hsa-miR-3609	CLIP-seq
MIRT1318312	hsa-miR-363	CLIP-seq
MIRT1318313	hsa-miR-367	CLIP-seq
MIRT1318314	hsa-miR-455-3p	CLIP-seq
MIRT1318315	hsa-miR-4645-3p	CLIP-seq
MIRT1318316	hsa-miR-4796-3p	CLIP-seq
MIRT1318317	hsa-miR-519d	CLIP-seq
MIRT1318318	hsa-miR-542-3p	CLIP-seq
MIRT1318319	hsa-miR-548ah	CLIP-seq
MIRT1318320	hsa-miR-9	CLIP-seq
MIRT1318321	hsa-miR-92a	CLIP-seq
MIRT1318322	hsa-miR-92b	CLIP-seq
MIRT1318323	hsa-miR-93	CLIP-seq
MIRT1318300	hsa-miR-106a	CLIP-seq
MIRT1318301	hsa-miR-106b	CLIP-seq
MIRT1318324	hsa-miR-128	CLIP-seq
MIRT1318302	hsa-miR-1324	CLIP-seq
MIRT1318303	hsa-miR-142-5p	CLIP-seq
MIRT1318304	hsa-miR-17	CLIP-seq
MIRT1318325	hsa-miR-1915	CLIP-seq
MIRT1318326	hsa-miR-193a-5p	CLIP-seq
MIRT1318327	hsa-miR-205	CLIP-seq
MIRT1318305	hsa-miR-20a	CLIP-seq
MIRT1318306	hsa-miR-20b	CLIP-seq
MIRT1318307	hsa-miR-25	CLIP-seq
MIRT1318328	hsa-miR-27a	CLIP-seq
MIRT1318329	hsa-miR-27b	CLIP-seq
MIRT1318308	hsa-miR-302f	CLIP-seq
MIRT1318330	hsa-miR-3126-5p	CLIP-seq
MIRT1318309	hsa-miR-3165	CLIP-seq
MIRT1318331	hsa-miR-3179	CLIP-seq
MIRT1318332	hsa-miR-3184	CLIP-seq
MIRT1318310	hsa-miR-32	CLIP-seq
MIRT1318333	hsa-miR-3202	CLIP-seq
MIRT1318311	hsa-miR-3609	CLIP-seq
MIRT1318334	hsa-miR-361-3p	CLIP-seq
MIRT1318312	hsa-miR-363	CLIP-seq
MIRT1318313	hsa-miR-367	CLIP-seq
MIRT1318335	hsa-miR-3918	CLIP-seq
MIRT1318336	hsa-miR-4419a	CLIP-seq
MIRT1318337	hsa-miR-4510	CLIP-seq
MIRT1318338	hsa-miR-4512	CLIP-seq
MIRT1318339	hsa-miR-4537	CLIP-seq
MIRT1318314	hsa-miR-455-3p	CLIP-seq
MIRT1318340	hsa-miR-4640-3p	CLIP-seq
MIRT1318315	hsa-miR-4645-3p	CLIP-seq
MIRT1318341	hsa-miR-4685-5p	CLIP-seq
MIRT1318342	hsa-miR-4726-3p	CLIP-seq
MIRT1318343	hsa-miR-4747-5p	CLIP-seq
MIRT1318344	hsa-miR-4757-5p	CLIP-seq
MIRT1318316	hsa-miR-4796-3p	CLIP-seq
MIRT1318345	hsa-miR-491-5p	CLIP-seq
MIRT1318317	hsa-miR-519d	CLIP-seq
MIRT1318346	hsa-miR-541	CLIP-seq
MIRT1318318	hsa-miR-542-3p	CLIP-seq
MIRT1318319	hsa-miR-548ah	CLIP-seq
MIRT1318347	hsa-miR-602	CLIP-seq
MIRT1318348	hsa-miR-654-5p	CLIP-seq
MIRT1318320	hsa-miR-9	CLIP-seq
MIRT1318321	hsa-miR-92a	CLIP-seq
MIRT1318322	hsa-miR-92b	CLIP-seq
MIRT1318323	hsa-miR-93	CLIP-seq
MIRT1318300	hsa-miR-106a	CLIP-seq
MIRT1318301	hsa-miR-106b	CLIP-seq
MIRT1318303	hsa-miR-142-5p	CLIP-seq
MIRT2094658	hsa-miR-1587	CLIP-seq
MIRT1318304	hsa-miR-17	CLIP-seq
MIRT2094659	hsa-miR-1827	CLIP-seq
MIRT1318305	hsa-miR-20a	CLIP-seq
MIRT1318306	hsa-miR-20b	CLIP-seq
MIRT1318307	hsa-miR-25	CLIP-seq
MIRT2094660	hsa-miR-2682	CLIP-seq
MIRT2094661	hsa-miR-3064-5p	CLIP-seq
MIRT1318310	hsa-miR-32	CLIP-seq
MIRT2094662	hsa-miR-34a	CLIP-seq
MIRT2094663	hsa-miR-34c-5p	CLIP-seq
MIRT1318311	hsa-miR-3609	CLIP-seq
MIRT1318312	hsa-miR-363	CLIP-seq
MIRT2094664	hsa-miR-3652	CLIP-seq
MIRT1318313	hsa-miR-367	CLIP-seq
MIRT2094665	hsa-miR-378g	CLIP-seq
MIRT2094666	hsa-miR-4430	CLIP-seq
MIRT2094667	hsa-miR-4492	CLIP-seq
MIRT2094668	hsa-miR-4498	CLIP-seq
MIRT2094669	hsa-miR-449a	CLIP-seq
MIRT2094670	hsa-miR-449b	CLIP-seq
MIRT2094671	hsa-miR-449c	CLIP-seq
MIRT2094672	hsa-miR-4505	CLIP-seq
MIRT2094673	hsa-miR-4649-3p	CLIP-seq
MIRT2094674	hsa-miR-4656	CLIP-seq
MIRT2094675	hsa-miR-4675	CLIP-seq
MIRT2094676	hsa-miR-4741	CLIP-seq
MIRT1318316	hsa-miR-4796-3p	CLIP-seq
MIRT1318317	hsa-miR-519d	CLIP-seq
MIRT1318319	hsa-miR-548ah	CLIP-seq
MIRT2094677	hsa-miR-591	CLIP-seq
MIRT2094678	hsa-miR-762	CLIP-seq
MIRT1318321	hsa-miR-92a	CLIP-seq
MIRT1318322	hsa-miR-92b	CLIP-seq
MIRT1318323	hsa-miR-93	CLIP-seq
MIRT1318300	hsa-miR-106a	CLIP-seq
MIRT1318301	hsa-miR-106b	CLIP-seq
MIRT1318303	hsa-miR-142-5p	CLIP-seq
MIRT1318304	hsa-miR-17	CLIP-seq
MIRT2094659	hsa-miR-1827	CLIP-seq
MIRT1318305	hsa-miR-20a	CLIP-seq
MIRT1318306	hsa-miR-20b	CLIP-seq
MIRT1318311	hsa-miR-3609	CLIP-seq
MIRT1318316	hsa-miR-4796-3p	CLIP-seq
MIRT1318317	hsa-miR-519d	CLIP-seq
MIRT1318319	hsa-miR-548ah	CLIP-seq
MIRT1318323	hsa-miR-93	CLIP-seq
MIRT1318300	hsa-miR-106a	CLIP-seq
MIRT1318301	hsa-miR-106b	CLIP-seq
MIRT1318324	hsa-miR-128	CLIP-seq
MIRT1318302	hsa-miR-1324	CLIP-seq
MIRT1318303	hsa-miR-142-5p	CLIP-seq
MIRT1318304	hsa-miR-17	CLIP-seq
MIRT1318325	hsa-miR-1915	CLIP-seq
MIRT1318326	hsa-miR-193a-5p	CLIP-seq
MIRT1318327	hsa-miR-205	CLIP-seq
MIRT1318305	hsa-miR-20a	CLIP-seq
MIRT1318306	hsa-miR-20b	CLIP-seq
MIRT1318328	hsa-miR-27a	CLIP-seq
MIRT1318329	hsa-miR-27b	CLIP-seq
MIRT1318308	hsa-miR-302f	CLIP-seq
MIRT1318330	hsa-miR-3126-5p	CLIP-seq
MIRT1318309	hsa-miR-3165	CLIP-seq
MIRT1318331	hsa-miR-3179	CLIP-seq
MIRT1318332	hsa-miR-3184	CLIP-seq
MIRT1318333	hsa-miR-3202	CLIP-seq
MIRT1318311	hsa-miR-3609	CLIP-seq
MIRT1318336	hsa-miR-4419a	CLIP-seq
MIRT1318337	hsa-miR-4510	CLIP-seq
MIRT1318338	hsa-miR-4512	CLIP-seq
MIRT1318314	hsa-miR-455-3p	CLIP-seq
MIRT1318340	hsa-miR-4640-3p	CLIP-seq
MIRT1318315	hsa-miR-4645-3p	CLIP-seq
MIRT1318342	hsa-miR-4726-3p	CLIP-seq
MIRT1318343	hsa-miR-4747-5p	CLIP-seq
MIRT2319136	hsa-miR-4749-3p	CLIP-seq
MIRT1318344	hsa-miR-4757-5p	CLIP-seq
MIRT1318316	hsa-miR-4796-3p	CLIP-seq
MIRT1318317	hsa-miR-519d	CLIP-seq
MIRT1318318	hsa-miR-542-3p	CLIP-seq
MIRT1318319	hsa-miR-548ah	CLIP-seq
MIRT1318347	hsa-miR-602	CLIP-seq
MIRT2319137	hsa-miR-873	CLIP-seq
MIRT1318320	hsa-miR-9	CLIP-seq
MIRT1318323	hsa-miR-93	CLIP-seq
MIRT1318300	hsa-miR-106a	CLIP-seq
MIRT1318301	hsa-miR-106b	CLIP-seq
MIRT1318303	hsa-miR-142-5p	CLIP-seq
MIRT1318304	hsa-miR-17	CLIP-seq
MIRT1318305	hsa-miR-20a	CLIP-seq
MIRT1318306	hsa-miR-20b	CLIP-seq
MIRT1318311	hsa-miR-3609	CLIP-seq
MIRT1318316	hsa-miR-4796-3p	CLIP-seq
MIRT1318317	hsa-miR-519d	CLIP-seq
MIRT1318319	hsa-miR-548ah	CLIP-seq
MIRT1318323	hsa-miR-93	CLIP-seq
MIRT1318324	hsa-miR-128	CLIP-seq
MIRT1318328	hsa-miR-27a	CLIP-seq
MIRT1318329	hsa-miR-27b	CLIP-seq
MIRT1318330	hsa-miR-3126-5p	CLIP-seq
MIRT1318331	hsa-miR-3179	CLIP-seq
MIRT1318333	hsa-miR-3202	CLIP-seq
MIRT1318336	hsa-miR-4419a	CLIP-seq
MIRT1318337	hsa-miR-4510	CLIP-seq
MIRT1318343	hsa-miR-4747-5p	CLIP-seq
MIRT2458608	hsa-miR-1253	CLIP-seq
MIRT2458609	hsa-miR-1262	CLIP-seq
MIRT2458610	hsa-miR-3936	CLIP-seq
MIRT2458611	hsa-miR-4426	CLIP-seq
MIRT2458612	hsa-miR-4647	CLIP-seq
MIRT2458613	hsa-miR-4662b	CLIP-seq
MIRT2458614	hsa-miR-4701-3p	CLIP-seq
MIRT1318344	hsa-miR-4757-5p	CLIP-seq
MIRT2458608	hsa-miR-1253	CLIP-seq
MIRT2458609	hsa-miR-1262	CLIP-seq
MIRT2458610	hsa-miR-3936	CLIP-seq
MIRT2458611	hsa-miR-4426	CLIP-seq
MIRT2458612	hsa-miR-4647	CLIP-seq
MIRT2458613	hsa-miR-4662b	CLIP-seq
MIRT2458614	hsa-miR-4701-3p	CLIP-seq
MIRT1318344	hsa-miR-4757-5p	CLIP-seq
MIRT2458608	hsa-miR-1253	CLIP-seq
MIRT2458609	hsa-miR-1262	CLIP-seq
MIRT2458610	hsa-miR-3936	CLIP-seq
MIRT2458611	hsa-miR-4426	CLIP-seq
MIRT2458612	hsa-miR-4647	CLIP-seq
MIRT2458613	hsa-miR-4662b	CLIP-seq
MIRT2458614	hsa-miR-4701-3p	CLIP-seq
MIRT1318344	hsa-miR-4757-5p	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001818	Process	Negative regulation of cytokine production	TAS	18508628
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9792677
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004711	Function	Ribosomal protein S6 kinase activity	NAS	11035004
GO:0005515	Function	Protein binding	IPI	9792677, 23602568, 25852190, 31980649, 32814053, 33961781
GO:0005524	Function	ATP binding	IDA	9792677
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	9792677, 11035004
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	9792677
GO:0006468	Process	Protein phosphorylation	IDA	9792677
GO:0006954	Process	Inflammatory response	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032793	Process	Positive regulation of CREB transcription factor activity	TAS	18508628
GO:0035175	Function	Histone H3S10 kinase activity	IEA
GO:0035175	Function	Histone H3S10 kinase activity	IMP	12773393
GO:0035556	Process	Intracellular signal transduction	IDA	9792677
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038202	Process	TORC1 signaling	IBA
GO:0043687	Process	Post-translational protein modification	IMP	12773393
GO:0044022	Function	Histone H3S28 kinase activity	IEA
GO:0044022	Function	Histone H3S28 kinase activity	IMP	12773393
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20018936
GO:0046872	Function	Metal ion binding	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS	18508628
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	20018936
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
603606	10433	ENSG00000162302

O75676

Protein name

Ribosomal protein S6 kinase alpha-4 (S6K-alpha-4) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 4) (Nuclear mitogen- and stress-activated protein kinase 2) (Ribosomal protein kinase B) (RSKB)

Protein function

Serine/threonine-protein kinase that is required for the mitogen or stress-induced phosphorylation of the transcription factors CREB1 and ATF1 and for the regulation of the transcription factor RELA, and that contributes to gene activation by hi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	33 → 301	Protein kinase domain	Domain
PF00433	Pkinase_C	322 → 361	Protein kinase C terminal domain	Family
PF00069	Pkinase	412 → 674	Protein kinase domain	Domain

Sequence

MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTY
LVLELLRGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS

Sequence length

772

Interactions

View interactions

	KEGG
	MAPK signaling pathway TNF signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Biliary cirrhosis	Biliary cirrhosis	GWASCAT_DG	21399635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29327245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23675462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17504382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17504382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35942506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infiltrating duct carcinoma of female breast	Infiltrating Duct Carcinoma Of Female Breast	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37462338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29327245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17504382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29327245, 30756420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	21399635		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	21399635		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24792438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30756420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24192080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17504382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	28930610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RPS6KA4 (ribosomal protein S6 kinase A4)