Gene Gene information from NCBI Gene database.
Entrez ID 89822
Gene name Potassium two pore domain channel subfamily K member 17
Gene symbol KCNK17
Synonyms (NCBI Gene)
K2p17.1TALK-2TALK2TASK-4TASK4
Chromosome 6
Chromosome location 6p21.2
Summary The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is activa
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs141016843 C>T Likely-pathogenic Missense variant, coding sequence variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0005267 Function Potassium channel activity IDA 11248242
GO:0005267 Function Potassium channel activity IEA
GO:0005515 Function Protein binding IPI 36063992
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607370 14465 ENSG00000124780
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96T54
Protein name Potassium channel subfamily K member 17 (2P domain potassium channel Talk-2) (Acid-sensitive potassium channel protein TASK-4) (TWIK-related acid-sensitive K(+) channel 4) (TWIK-related alkaline pH-activated K(+) channel 2) (TALK-2)
Protein function K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 80 157 Ion channel Family
PF07885 Ion_trans_2 185 269 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in aorta and coronary artery. Expressed in pancreas, in both endocrine (alpha, beta, gamma, delta, and epsilon) and exocrine (acinar and ductal) cells. {ECO:0000269|PubMed:11263999, ECO:0000269|PubMed
Sequence
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW
ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYG
NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQ
GVNHWASRLGGTWQDPDKARWLA
GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW
YKNMVSLWILFGMAWLALIIKLILSQLET
PGRVCSCCHHSSKEDFKSQSWRQGPDREPES
HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Sequence length 332
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    TWIK-related alkaline pH activated K+ channel (TALK)
Phase 4 - resting membrane potential
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATOPIC ECZEMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEART CONDUCTION DISEASE GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Atrial Fibrillation Atrial Fibrillation BEFREE 29753045
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 31581133 Inhibit
★☆☆☆☆
Found in Text Mining only
Cerebrovascular accident Stroke BEFREE 25179130
★☆☆☆☆
Found in Text Mining only
Conduction disorder of the heart Conduction Disorder Of The Heart BEFREE 24972929
★☆☆☆☆
Found in Text Mining only
Ischemic stroke Ischemic Stroke BEFREE 19647252, 23391755, 25179130
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 31581133
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of liver Liver Cancer BEFREE 31581133
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 24268366
★☆☆☆☆
Found in Text Mining only
Pulmonary Arterial Hypertension Pulmonary arterial hypertension Pubtator 34349187 Associate
★☆☆☆☆
Found in Text Mining only
Urothelial Carcinoma Urothelial Carcinoma BEFREE 24268366
★☆☆☆☆
Found in Text Mining only