Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	89801
Gene name	Protein phosphatase 1 regulatory subunit 3F
Gene symbol	PPP1R3F
Synonyms (NCBI Gene)	HB2ELL0XNC01-7P3.1R3F
Chromosome	X
Chromosome location	Xp11.23
Summary	This gene encodes a protein that has been identified as one of several type-1 protein phosphatase (PP1) regulatory subunits. One or two of these subunits, together with the well-conserved catalytic subunit, can form the PP1 holoenzyme, where the regulator

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT720055	hsa-miR-548n	HITS-CLIP	19536157
MIRT720054	hsa-miR-548az-5p	HITS-CLIP	19536157
MIRT720053	hsa-miR-548t-5p	HITS-CLIP	19536157
MIRT720051	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT720052	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT720050	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT720049	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT720048	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT720047	hsa-miR-4436b-5p	HITS-CLIP	19536157
MIRT720046	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT720055	hsa-miR-548n	HITS-CLIP	19536157
MIRT720054	hsa-miR-548az-5p	HITS-CLIP	19536157
MIRT720053	hsa-miR-548t-5p	HITS-CLIP	19536157
MIRT720051	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT720052	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT720050	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT720049	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT720048	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT720047	hsa-miR-4436b-5p	HITS-CLIP	19536157
MIRT720046	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT1256956	hsa-miR-1236	CLIP-seq
MIRT1256957	hsa-miR-127-5p	CLIP-seq
MIRT1256958	hsa-miR-134	CLIP-seq
MIRT1256959	hsa-miR-149	CLIP-seq
MIRT1256960	hsa-miR-15a	CLIP-seq
MIRT1256961	hsa-miR-15b	CLIP-seq
MIRT1256962	hsa-miR-16	CLIP-seq
MIRT1256963	hsa-miR-195	CLIP-seq
MIRT1256964	hsa-miR-214	CLIP-seq
MIRT1256965	hsa-miR-3118	CLIP-seq
MIRT1256966	hsa-miR-3136-5p	CLIP-seq
MIRT1256967	hsa-miR-3164	CLIP-seq
MIRT1256968	hsa-miR-3607-5p	CLIP-seq
MIRT1256969	hsa-miR-3619-5p	CLIP-seq
MIRT1256970	hsa-miR-424	CLIP-seq
MIRT1256971	hsa-miR-4252	CLIP-seq
MIRT1256972	hsa-miR-4292	CLIP-seq
MIRT1256973	hsa-miR-4308	CLIP-seq
MIRT1256974	hsa-miR-4439	CLIP-seq
MIRT1256975	hsa-miR-4501	CLIP-seq
MIRT1256976	hsa-miR-4513	CLIP-seq
MIRT1256977	hsa-miR-4690-5p	CLIP-seq
MIRT1256978	hsa-miR-4691-5p	CLIP-seq
MIRT1256979	hsa-miR-497	CLIP-seq
MIRT1256980	hsa-miR-604	CLIP-seq
MIRT1256981	hsa-miR-647	CLIP-seq
MIRT1256982	hsa-miR-653	CLIP-seq
MIRT1256983	hsa-miR-761	CLIP-seq
MIRT2075649	hsa-miR-1182	CLIP-seq
MIRT2075650	hsa-miR-1224-3p	CLIP-seq
MIRT1256956	hsa-miR-1236	CLIP-seq
MIRT2075651	hsa-miR-1255a	CLIP-seq
MIRT2075652	hsa-miR-1255b	CLIP-seq
MIRT2075653	hsa-miR-1260	CLIP-seq
MIRT2075654	hsa-miR-1260b	CLIP-seq
MIRT2075655	hsa-miR-1280	CLIP-seq
MIRT1256959	hsa-miR-149	CLIP-seq
MIRT2075656	hsa-miR-185	CLIP-seq
MIRT2075657	hsa-miR-188-3p	CLIP-seq
MIRT2075658	hsa-miR-2110	CLIP-seq
MIRT1256966	hsa-miR-3136-5p	CLIP-seq
MIRT2075659	hsa-miR-3150a-3p	CLIP-seq
MIRT2075660	hsa-miR-329	CLIP-seq
MIRT2075661	hsa-miR-362-3p	CLIP-seq
MIRT2075662	hsa-miR-3941	CLIP-seq
MIRT1256971	hsa-miR-4252	CLIP-seq
MIRT1256972	hsa-miR-4292	CLIP-seq
MIRT2075663	hsa-miR-4306	CLIP-seq
MIRT1256973	hsa-miR-4308	CLIP-seq
MIRT1256974	hsa-miR-4439	CLIP-seq
MIRT2075664	hsa-miR-4450	CLIP-seq
MIRT2075665	hsa-miR-4453	CLIP-seq
MIRT2075666	hsa-miR-4491	CLIP-seq
MIRT2075667	hsa-miR-4514	CLIP-seq
MIRT2075668	hsa-miR-4538	CLIP-seq
MIRT2075669	hsa-miR-4644	CLIP-seq
MIRT2075670	hsa-miR-4657	CLIP-seq
MIRT1256978	hsa-miR-4691-5p	CLIP-seq
MIRT2075671	hsa-miR-4692	CLIP-seq
MIRT2075672	hsa-miR-532-3p	CLIP-seq
MIRT2075673	hsa-miR-603	CLIP-seq
MIRT2075674	hsa-miR-943	CLIP-seq
MIRT2075650	hsa-miR-1224-3p	CLIP-seq
MIRT1256956	hsa-miR-1236	CLIP-seq
MIRT2075653	hsa-miR-1260	CLIP-seq
MIRT2075654	hsa-miR-1260b	CLIP-seq
MIRT2075655	hsa-miR-1280	CLIP-seq
MIRT1256959	hsa-miR-149	CLIP-seq
MIRT2302264	hsa-miR-369-3p	CLIP-seq
MIRT2302265	hsa-miR-374a	CLIP-seq
MIRT2302266	hsa-miR-374b	CLIP-seq
MIRT2302267	hsa-miR-410	CLIP-seq
MIRT1256971	hsa-miR-4252	CLIP-seq
MIRT1256972	hsa-miR-4292	CLIP-seq
MIRT1256973	hsa-miR-4308	CLIP-seq
MIRT1256978	hsa-miR-4691-5p	CLIP-seq
MIRT2075672	hsa-miR-532-3p	CLIP-seq
MIRT2075657	hsa-miR-188-3p	CLIP-seq
MIRT2439591	hsa-miR-100	CLIP-seq
MIRT2439592	hsa-miR-642a	CLIP-seq
MIRT2439593	hsa-miR-99a	CLIP-seq
MIRT2439594	hsa-miR-99b	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000164	Component	Protein phosphatase type 1 complex	IBA
GO:0005979	Process	Regulation of glycogen biosynthetic process	IBA
GO:0005979	Process	Regulation of glycogen biosynthetic process	IDA	21668450
GO:0008157	Function	Protein phosphatase 1 binding	IBA
GO:0016020	Component	Membrane	IDA	21668450
GO:0016020	Component	Membrane	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	21668450
GO:2000465	Process	Regulation of glycogen (starch) synthase activity	IDA	21668450
GO:2001069	Function	Glycogen binding	IBA
GO:2001069	Function	Glycogen binding	IDA	21668450

MIM	HGNC	e!Ensembl
301104	14944	ENSG00000049769

Q6ZSY5

Protein name

Protein phosphatase 1 regulatory subunit 3F (R3F)

Protein function

Glycogen-targeting subunit for protein phosphatase 1 (PP1).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03370	CBM_21	151 → 284	Carbohydrate/starch-binding module (family 21)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, skeletal muscle and heart. {ECO:0000269|PubMed:21668450}.

Sequence

MARTAPVEPPLRHSAPPSPAAGEPRTSVEAAVAPRRVLFADEALGLPLAQLRRYRPWGGP
GAGKMAAAAGQDGGGGGGADEDDDGEDGDEGEEEEEACPEPSPLCPVPAGGGFYLVPTFS
LPPAPGRLERLGRVMVELEALLPPPGAVPGGAGVWVPGGRPPVLRGLVRVLNRSFEKAVH
VRASHDGWASFCDHPARYVPRSPPWAGAGGTGAGDPILDPGLGLGPGQASASSPDDGGRT
DRFAFQLPFAEGAGDGARLDFVVRYETPEGTFWANNHGRNYTVLLRIAPAPTPTDAEGLP
QQQQLPQLEPQPECQGPVEAEARQLKSCMKPVRRRPAEEELKTKNMDDNTFAMAEHPDVQ
ESVGPLVAPTPLRPWPQMTLQVSDVPMTGNPAEEGDVPRSSPPVAFTEVLQAPAIRIPPS
SPLCGLGGSPRDQASGPDASEGATGPFLEPSQQQAEATWGVSSENGGGLEAVSGSEELLG
EDTIDQELEQLYLSHLSRLRAAVAAGGAGGGGEGSTDGGMSPSHPLGILTDRDLILKWPG
PERALNSALAEEITLHYARLGRGVELIKDTEDPDDEGEGEEGLSVTPSSPEGDSPKESPP
EILSGARSVVATMGDVWLPWAEGSGCDGPVVLGTEGQFIGDPEKGMGKDTSSLHMNRVIA
GVTESLGEAGTEAQIEVTSEWAGSLDPISGKEPASPVLLQGQNPTLLSPLGAEVCLSSVA
RPHVSSQDEKDAGPSLEPPKKSPTLAVPAECVCALPPQLRGPLTQTLGVLAGLVVVPVAL
NSGVSLLVLALCLSLAWFS

Sequence length

799

Interactions

View interactions

	KEGG
	Insulin signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPP1R3F Associated Neurodevelopmental Disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	GWASCAT_DG	30929738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30016992, 37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34145793	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	37531237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPP1R3F (protein phosphatase 1 regulatory subunit 3F)