Gene Gene information from NCBI Gene database.
Entrez ID 89781
Gene name HPS4 biogenesis of lysosomal organelles complex 3 subunit 2
Gene symbol HPS4
Synonyms (NCBI Gene)
BLOC3S2LE
Chromosome 22
Chromosome location 22q12.1
Summary This gene encodes a protein component of biogenesis of lysosome-related organelles complexes (BLOC). BLOC complexes are important for the formation of endosomal-lysosomal organelles such as melanosomes and platelet dense granules. Mutations in this gene r
SNPs SNP information provided by dbSNP.
16
SNP ID Visualize variation Clinical significance Consequence
rs61729175 G>A Conflicting-interpretations-of-pathogenicity 5 prime UTR variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant, missense variant
rs119471021 G>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant, intron variant
rs119471022 G>A,T Pathogenic Stop gained, 5 prime UTR variant, non coding transcript variant, genic upstream transcript variant, missense variant, coding sequence variant
rs119471023 G>A,C Pathogenic Stop gained, 5 prime UTR variant, non coding transcript variant, genic upstream transcript variant, upstream transcript variant, missense variant, coding sequence variant
rs119471024 C>A Pathogenic Stop gained, 5 prime UTR variant, non coding transcript variant, genic upstream transcript variant, upstream transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
461
miRTarBase ID miRNA Experiments Reference
MIRT002809 hsa-miR-1-3p Microarray 15685193
MIRT002809 hsa-miR-1-3p Microarray 15685193
MIRT002809 hsa-miR-1-3p Microarray 18668037
MIRT029994 hsa-miR-26b-5p Microarray 19088304
MIRT035919 hsa-miR-1180-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IDA 23084991
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005515 Function Protein binding IPI 12756248, 20048159, 23084991
GO:0005737 Component Cytoplasm IDA 12756248
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606682 15844 ENSG00000100099
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NQG7
Protein name BLOC-3 complex member HPS4 (Hermansky-Pudlak syndrome 4 protein) (Light-ear protein homolog)
Protein function Component of the BLOC-3 complex, a complex that acts as a guanine exchange factor (GEF) for RAB32 and RAB38, promotes the exchange of GDP to GTP, converting them from an inactive GDP-bound form into an active GTP-bound form. The BLOC-3 complex p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF19031 Intu_longin_1 15 121 First Longin domain of INTU, CCZ1 and HPS4 Domain
PF19033 Intu_longin_3 598 699 Intu longin-like domain 3 Domain
Sequence
MATSTSTEAKSASWWNYFFLYDGSKVKEEGDPTRAGICYFYPSQTLLDQQELLCGQIAGV
VRCVSDISDSPPTLVRLRKLKFAIKVDGDYLWVLGCAVELPDVSCKRFLDQLVGFFNFYN
G
PVSLAYENCSQEELSTEWDTFIEQILKNTSDLHKIFNSLWNLDQTKVEPLLLLKAARIL
QTCQRSPHILAGCILYKGLIVSTQLPPSLTAKVLLHRTAPQEQRLPTGEDAPQEHGAALP
PNVQIIPVFVTKEEAISLHEFPVEQMTRSLASPAGLQDGSAQHHPKGGSTSALKENATGH
VESMAWTTPDPTSPDEACPDGRKENGCLSGHDLESIRPAGLHNSARGEVLGLSSSLGKEL
VFLQEELDLSEIHIPEAQEVEMASGHFAFLHVPVPDGRAPYCKASLSASSSLEPTPPEDT
AISSLRPPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPLPRRTRRPLLLPRLDPGQRG
NKLPTGEQGLDEDVDGVCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVR
MNLYTHCVKGLVLSLLAEEPLLGDSAAIEEVYHSSLASLNGLEVHLKETLPRDEAASTSS
TYNFTHYDRIQSLLMANLPQVATPQDRRFLQAVSLMHSEFAQLPALYEMTVRNASTAVYA
CCNPIQETYFQQLAPAARSSGFPNPQDGAFSLSGKAKQK
LLKHGVNLL
Sequence length 708
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RAB GEFs exchange GTP for GDP on RABs
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
30
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Hermansky-Pudlak syndrome Likely pathogenic; Pathogenic rs2146534178, rs150216540, rs119471023, rs1476012328, rs369053765, rs2518199038, rs1602079277 RCV001553743
RCV002271847
RCV004799731
RCV002510397
RCV000214159
View all (2 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hermansky-Pudlak syndrome 4 Likely pathogenic; Pathogenic rs374343385, rs2146555632, rs773968140, rs2146241760, rs2146757484, rs150216540, rs763190774, rs119471021, rs281865100, rs281865097, rs119471022, rs119471023, rs119471024, rs119471025, rs372833027
View all (32 more)
RCV002570781
RCV001783430
RCV003471166
RCV002245423
RCV003992620
View all (44 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Melanoma Likely pathogenic rs2146757484, rs2518649872 RCV005930046
RCV005927712
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Adrenocortical carcinoma, hereditary Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Albinism Albinism BEFREE 28289846
★☆☆☆☆
Found in Text Mining only
Albinism Albinism Pubtator 35488210 Associate
★☆☆☆☆
Found in Text Mining only
Albinism Albinism HPO_DG
★☆☆☆☆
Found in Text Mining only
Albinism Oculocutaneous Oculocutaneous albinism Pubtator 18463683, 30791930 Associate
★☆☆☆☆
Found in Text Mining only
Albinism, Ocular Ocular albinism HPO_DG
★☆☆☆☆
Found in Text Mining only
Albinism, Oculocutaneous Oculocutaneous albinism BEFREE 18326704, 18463683, 19398212, 31415434
★☆☆☆☆
Found in Text Mining only
Blood Coagulation Disorders Blood Coagulation Disorders BEFREE 19398212
★☆☆☆☆
Found in Text Mining only
Colitis Colitis LHGDN 12664304
★☆☆☆☆
Found in Text Mining only
Hermanski-Pudlak Syndrome Hermansky-Pudlak Syndrome BEFREE 11836498, 12664304, 12756248, 12847290, 24168225, 30791930, 30837268
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hermanski-Pudlak Syndrome Hermansky-Pudlak Syndrome LHGDN 12664304, 12756248
★★☆☆☆
Found in Text Mining + Unknown/Other Associations