Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8971
Gene name	H1.10 linker histone
Gene symbol	H1-10
Synonyms (NCBI Gene)	H1.10H1FXH1X
Chromosome	3
Chromosome location	3q21.3
Summary	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0006334	Process	Nucleosome assembly	IEA
GO:0030261	Process	Chromosome condensation	IBA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0031492	Function	Nucleosomal DNA binding	IBA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045910	Process	Negative regulation of DNA recombination	IBA

MIM	HGNC	e!Ensembl
602785	4722	ENSG00000184897

Q92522

Protein name

Histone H1.10 (Histone H1x)

Protein function

Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures.

PDB

2LSO , 6L9Z , 7K60 , 7K63 , 8YTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00538	Linker_histone	46 → 117	linker histone H1 and H5 family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously.

Sequence

MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLG
ERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKK
LEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKK
DKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK

Sequence length

213

Interactions

View interactions

Related Genes Genes most often co-reported with H1-10 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for H1-10.

Diseases Linked via Similar Genes Diseases curated for genes most similar to H1-10 (see Related Genes above), that are NOT already directly curated for H1-10 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to H1-10.

H1-10 (H1.10 linker histone)

Bookmark This Gene