CCND3 (cyclin D3)

Gene

• Entrez ID: 896
• Gene name: Cyclin D3
• Gene symbol: CCND3
• Synonyms (NCBI Gene): -
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001010	hsa-miR-34a-5p	Western blot	18406353
MIRT000940	hsa-miR-16-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT000937	hsa-miR-424-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT000937	hsa-miR-424-5p	qRT-PCR, flow, Western blot	18701644
MIRT000940	hsa-miR-16-5p	qRT-PCR, flow, Western blot	18701644
MIRT000940	hsa-miR-16-5p	Luciferase reporter assay	18701644
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT052181	hsa-let-7b-5p	CLASH	23622248
MIRT046238	hsa-miR-27b-3p	CLASH	23622248
MIRT043067	hsa-miR-324-5p	CLASH	23622248
MIRT039712	hsa-miR-615-3p	CLASH	23622248
MIRT039712	hsa-miR-615-3p	CLASH	23622248
MIRT006299	hsa-miR-138-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23208504
MIRT006299	hsa-miR-138-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23208504
MIRT053075	hsa-miR-503-5p	Flow, qRT-PCR, Western blot	23967867
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	23544130
MIRT437796	hsa-miR-497-5p	Luciferase reporter assay, Western blot	23544130
MIRT006299	hsa-miR-138-5p	qRT-PCR	25439221
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT440984	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440984	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT006299	hsa-miR-138-5p	Western blot	26823826
MIRT732667	hsa-miR-34a-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34056735
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT871733	hsa-miR-1226	CLIP-seq
MIRT871734	hsa-miR-1301	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT871736	hsa-miR-15a	CLIP-seq
MIRT871737	hsa-miR-15b	CLIP-seq
MIRT871738	hsa-miR-16	CLIP-seq
MIRT871739	hsa-miR-195	CLIP-seq
MIRT871740	hsa-miR-214	CLIP-seq
MIRT871741	hsa-miR-3200-3p	CLIP-seq
MIRT871742	hsa-miR-3614-3p	CLIP-seq
MIRT871743	hsa-miR-3619-5p	CLIP-seq
MIRT871744	hsa-miR-3662	CLIP-seq
MIRT871745	hsa-miR-3679-3p	CLIP-seq
MIRT871746	hsa-miR-3938	CLIP-seq
MIRT871747	hsa-miR-424	CLIP-seq
MIRT871748	hsa-miR-4291	CLIP-seq
MIRT871749	hsa-miR-4305	CLIP-seq
MIRT871750	hsa-miR-4496	CLIP-seq
MIRT871751	hsa-miR-4640-5p	CLIP-seq
MIRT871752	hsa-miR-4726-5p	CLIP-seq
MIRT871753	hsa-miR-497	CLIP-seq
MIRT871754	hsa-miR-5047	CLIP-seq
MIRT871755	hsa-miR-545	CLIP-seq
MIRT871756	hsa-miR-761	CLIP-seq
MIRT871757	hsa-miR-922	CLIP-seq
MIRT871758	hsa-miR-101	CLIP-seq
MIRT871759	hsa-miR-1207-5p	CLIP-seq
MIRT871760	hsa-miR-1265	CLIP-seq
MIRT871761	hsa-miR-1293	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT871762	hsa-miR-144	CLIP-seq
MIRT871763	hsa-miR-1827	CLIP-seq
MIRT871764	hsa-miR-2392	CLIP-seq
MIRT871765	hsa-miR-3612	CLIP-seq
MIRT871766	hsa-miR-3689d	CLIP-seq
MIRT871767	hsa-miR-4254	CLIP-seq
MIRT871768	hsa-miR-4328	CLIP-seq
MIRT871769	hsa-miR-4443	CLIP-seq
MIRT871770	hsa-miR-4483	CLIP-seq
MIRT871751	hsa-miR-4640-5p	CLIP-seq
MIRT871752	hsa-miR-4726-5p	CLIP-seq
MIRT871771	hsa-miR-4763-3p	CLIP-seq
MIRT871772	hsa-miR-513b	CLIP-seq
MIRT871773	hsa-miR-556-3p	CLIP-seq
MIRT871774	hsa-miR-582-5p	CLIP-seq
MIRT871775	hsa-miR-650	CLIP-seq
MIRT871776	hsa-miR-885-3p	CLIP-seq
MIRT871777	hsa-miR-940	CLIP-seq
MIRT871736	hsa-miR-15a	CLIP-seq
MIRT871737	hsa-miR-15b	CLIP-seq
MIRT871738	hsa-miR-16	CLIP-seq
MIRT871739	hsa-miR-195	CLIP-seq
MIRT871744	hsa-miR-3662	CLIP-seq
MIRT871747	hsa-miR-424	CLIP-seq
MIRT1958728	hsa-miR-4701-5p	CLIP-seq
MIRT871753	hsa-miR-497	CLIP-seq
MIRT1958729	hsa-miR-588	CLIP-seq
MIRT871759	hsa-miR-1207-5p	CLIP-seq
MIRT2195442	hsa-miR-1245b-3p	CLIP-seq
MIRT2195443	hsa-miR-1273g	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT2195444	hsa-miR-138	CLIP-seq
MIRT871763	hsa-miR-1827	CLIP-seq
MIRT2195445	hsa-miR-218	CLIP-seq
MIRT2195446	hsa-miR-3120-3p	CLIP-seq
MIRT2195447	hsa-miR-330-3p	CLIP-seq
MIRT871765	hsa-miR-3612	CLIP-seq
MIRT2195448	hsa-miR-3690	CLIP-seq
MIRT2195449	hsa-miR-382	CLIP-seq
MIRT2195450	hsa-miR-3909	CLIP-seq
MIRT2195451	hsa-miR-409-5p	CLIP-seq
MIRT871767	hsa-miR-4254	CLIP-seq
MIRT2195452	hsa-miR-4265	CLIP-seq
MIRT2195453	hsa-miR-4296	CLIP-seq
MIRT2195454	hsa-miR-4322	CLIP-seq
MIRT2195455	hsa-miR-4435	CLIP-seq
MIRT871769	hsa-miR-4443	CLIP-seq
MIRT2195456	hsa-miR-4484	CLIP-seq
MIRT2195457	hsa-miR-4648	CLIP-seq
MIRT2195458	hsa-miR-4654	CLIP-seq
MIRT2195459	hsa-miR-4733-3p	CLIP-seq
MIRT871771	hsa-miR-4763-3p	CLIP-seq
MIRT2195460	hsa-miR-4769-5p	CLIP-seq
MIRT2195461	hsa-miR-524-3p	CLIP-seq
MIRT2195462	hsa-miR-525-3p	CLIP-seq
MIRT2195463	hsa-miR-561	CLIP-seq
MIRT871775	hsa-miR-650	CLIP-seq
MIRT871777	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF5	Activation	16300731
ETV4	Activation	17467662
NR3C1	Repression	9154817
STAT3	Activation	15184887

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	7603984, 8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	33854239
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	8114739
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	9106657, 9311810, 11896535, 14641107, 15232106, 16189514, 16721056, 17517622, 19237555, 21516116, 21988832, 23455922, 23602568, 25241761, 25416956, 25910212, 26496610, 27107012, 28514442, 29997244, 30833792, 31515488, 32296183, 32707033, 32814053, 33961781, 34591612, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	8114739
GO:0042098	Process	T cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	8114739
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	8114739
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	33854239
GO:0097130	Component	Cyclin D3-CDK4 complex	IPI	19237555
GO:0097133	Component	Cyclin D3-CDK6 complex	IPI	8114739
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IBA

Other IDs

• MIM: 123834
• HGNC: 1585
• e!Ensembl: ENSG00000112576

Protein

• UniProt ID: P30281
• Protein name: G1/S-specific cyclin-D3
• Protein function: Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition (PubMed:8114739). Phosphorylation of R
• PDB: 3G33, 7SJ3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	26 → 153	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	155 → 279	Cyclin, C-terminal domain	Domain

• Sequence:

  MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
  AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
  IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
  HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
  RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

• Sequence length: 292

Pathways

KEGG:

Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
Wnt signaling pathway
Hippo signaling pathway
Focal adhesion
JAK-STAT signaling pathway
Measles
Influenza A
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Chemical carcinogenesis - receptor activation

Reactome:

Transcriptional regulation of white adipocyte differentiation
MAPK6/MAPK4 signaling
Cyclin D associated events in G1
Regulation of RUNX1 Expression and Activity

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	26165351		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11301189		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10573135		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17885491		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	14576819		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10803523, 16322284, 19639271, 20107311		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	27493231		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	28148900		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	20113529		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11457838	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10397744, 28209658, 9376597		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	11895902, 16322284		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15082203, 16482499, 22895549, 23830405, 30950241		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	23199169	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12611462, 18507837, 19142864, 19242061, 20229177, 21829727, 25766325, 29562954, 30950241		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15569667, 18507837, 19242061, 20003265, 25927147, 29562954, 38198023, 9528753	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10597239, 31849147, 8959341		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22885699, 28209658, 31849147, 32449435, 33020271, 34472720, 36201743, 37053555	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11418483	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14666699, 16482499, 23830405, 8688970		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23082062	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15082203, 16482499, 20821231, 22895549, 23830405, 30950241		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21555162		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20113529, 31381571	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14666699		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35792239	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19704260		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16012517, 19542220	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15980885	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28067908		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27380896, 28812028	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27380896		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10803523, 16322284, 19639271, 20107311, 31849147		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	20496072		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10682682, 11389092		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	10682682		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	16884382		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16884382	Associate	★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 2	Partial Lipodystrophy	BEFREE	18805829		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	13679452		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	18701138		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	20062012	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10416984, 10585593, 22217655		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10416984	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22217655	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10416984, 10585593, 22217655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	10416984, 30548945	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	12778072		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Pubtator	10416984	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	12890807	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	32871763	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	20062012	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	16445666	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35687490	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	28067908		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	27085780		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	15671552		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17300668		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20062012, 30381403, 34103301	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15667533		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22362728, 23082062, 29916745, 31301177		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26144250		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10803523, 26985765, 9376597		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17300668, 18391076		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20062012, 25839159, 33399078, 35687490	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	27959929	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15305377, 19704260, 21292305		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	15305377		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15305377, 28209658		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15305377, 28209658		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10416984		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	18391076		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	9376597		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10208420, 18507837, 19142864, 19242061, 20229177, 21829727, 25766325, 29562954, 30950241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21555162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11469683		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18084330, 22895549		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15082203, 16482499, 22895549, 23830405, 30950241		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10482983, 11675358, 13679452, 15475449, 16322284, 18485879, 20107311, 21555162, 22719872, 31198407, 8688970		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15569667, 16569260, 17467662		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19142864, 20229177, 21829727, 22037875		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	19704260, 31773249, 7742549, 9376597		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11253137, 16815849, 20496072	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16815849		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31103822		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	28801450	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	19996118		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11418483, 12846810, 15090448, 15305377, 16129847, 19704260		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11418483, 14531906, 16728703, 17914559, 19446321, 20093236, 24638926	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22596089		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23208504		★☆☆☆☆ Found in Text Mining only
Myoclonic dystonia	Myoclonic dystonia	Pubtator	18391076	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	28106288		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	40156865	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29367693	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11178974, 11418483, 12112531, 13679452, 14633785, 15082203, 15305377, 15475449, 15671552, 16270038, 16482499, 18084330, 18381641, 18452128, 20229177, 22362728, 23208504, 25300797, 28481029, 28607489, 28927034, 29362401, 31198407, 31301177, 31302234		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14500366, 33456359	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26201895, 29416000		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25300797		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25300797, 25418192	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19738611	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11469683		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20113529		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11469683	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28927034		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25182869		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25182869	Associate	★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	31462148		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17300668, 19001083, 28151717		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	28671688		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18084330, 22895549		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18084330		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33522043	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	18358634		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18358634		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24987858		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	25300797		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28927034		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15671552		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19210573	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10225442		★☆☆☆☆ Found in Text Mining only
Thyroid cancer Hurthle cell	Hurthle cell thyroid cancer	Pubtator	19787802	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	10510327	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	23830405		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19762144	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	7742549		★☆☆☆☆ Found in Text Mining only