Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8941
Gene name	Cyclin dependent kinase 5 regulatory subunit 2
Gene symbol	CDK5R2
Synonyms (NCBI Gene)	NCK5AIP39p39nck5ai
Chromosome	2
Chromosome location	2q35
Summary	The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define

Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020417	hsa-miR-106b-5p	Microarray	17242205
MIRT737618	hsa-miR-1324	CLIP-seq
MIRT881293	hsa-miR-185	CLIP-seq
MIRT881294	hsa-miR-3125	CLIP-seq
MIRT881295	hsa-miR-3166	CLIP-seq
MIRT881296	hsa-miR-3173-3p	CLIP-seq
MIRT881297	hsa-miR-3612	CLIP-seq
MIRT881298	hsa-miR-3916	CLIP-seq
MIRT881299	hsa-miR-4306	CLIP-seq
MIRT881300	hsa-miR-4419a	CLIP-seq
MIRT881301	hsa-miR-4426	CLIP-seq
MIRT881302	hsa-miR-4459	CLIP-seq
MIRT737619	hsa-miR-4497	CLIP-seq
MIRT881303	hsa-miR-4510	CLIP-seq
MIRT881304	hsa-miR-4643	CLIP-seq
MIRT881305	hsa-miR-4644	CLIP-seq
MIRT881306	hsa-miR-4647	CLIP-seq
MIRT881307	hsa-miR-4662b	CLIP-seq
MIRT881308	hsa-miR-4694-3p	CLIP-seq
MIRT881309	hsa-miR-4695-5p	CLIP-seq
MIRT881310	hsa-miR-4708-5p	CLIP-seq
MIRT881311	hsa-miR-4771	CLIP-seq
MIRT881312	hsa-miR-4779	CLIP-seq
MIRT881313	hsa-miR-642b	CLIP-seq
MIRT881314	hsa-miR-650	CLIP-seq
MIRT2197778	hsa-miR-3185	CLIP-seq
MIRT2197779	hsa-miR-3714	CLIP-seq
MIRT881302	hsa-miR-4459	CLIP-seq
MIRT2197780	hsa-miR-4731-3p	CLIP-seq
MIRT2197781	hsa-miR-4801	CLIP-seq
MIRT881313	hsa-miR-642b	CLIP-seq
MIRT2197782	hsa-miR-764	CLIP-seq
MIRT2197783	hsa-miR-765	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	7592934
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	ISS
GO:0001764	Process	Neuron migration	IEA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007420	Process	Brain development	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016533	Component	Protein kinase 5 complex	IEA
GO:0016533	Component	Protein kinase 5 complex	ISS
GO:0019901	Function	Protein kinase binding	IBA
GO:0021549	Process	Cerebellum development	IEA
GO:0021722	Process	Superior olivary nucleus maturation	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021819	Process	Layer formation in cerebral cortex	IEA
GO:0030426	Component	Growth cone	IBA
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	IEA
GO:0051493	Process	Regulation of cytoskeleton organization	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IBA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	ISS
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	17491008
GO:0098793	Component	Presynapse	IEA

MIM	HGNC	e!Ensembl
603764	1776	ENSG00000171450

Q13319

Protein name

Cyclin-dependent kinase 5 activator 2 (CDK5 activator 2) (Cyclin-dependent kinase 5 regulatory subunit 2) (p39) (p39I)

Protein function

Activator of CDK5/TPKII.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03261	CDK5_activator	165 → 331	Cyclin-dependent kinase 5 activator protein	Family

Tissue specificity

TISSUE SPECIFICITY: Brain and neuron specific.

Sequence

MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKP
LAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKH
WTMNLDR

Sequence length

367

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBACEOUS GLAND DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	15917097		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21825040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30452490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21825040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22741533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30452490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30452490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21825040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30452490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21825040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21825040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30452490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	36713370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDK5R2 (cyclin dependent kinase 5 regulatory subunit 2)