CCND2 (cyclin D2)

Gene

• Entrez ID: 894
• Gene name: Cyclin D2
• Gene symbol: CCND2
• Synonyms (NCBI Gene): KIAK0002, MPPH3
• Chromosome: 12
• Chromosome location: 12p13.32
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777618	A>G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs587777619	A>T	Pathogenic	Coding sequence variant, stop gained
rs587777620	C>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs587777621	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs587777622	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs777786993	T>C,G	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000285	hsa-miR-15a-5p	Luciferase reporter assay	19549910
MIRT000285	hsa-miR-15a-5p	Luciferase reporter assay	19549910
MIRT003555	hsa-miR-302b-3p	Luciferase reporter assay, Western blot	18930031
MIRT003555	hsa-miR-302b-3p	Luciferase reporter assay, Western blot	18930031
MIRT003431	hsa-miR-16-5p	Review	20130964
MIRT003835	hsa-let-7b-5p	Luciferase reporter assay	17699775
MIRT000112	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	19524505
MIRT000112	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	19524505
MIRT003835	hsa-let-7b-5p	qRT-PCR	17942906
MIRT005673	hsa-miR-302d-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	21062975
MIRT005673	hsa-miR-302d-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	21062975
MIRT005673	hsa-miR-302d-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	21062975
MIRT005478	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20418948
MIRT005478	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20418948
MIRT005478	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20418948
MIRT005478	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20418948
MIRT005848	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT005854	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT005862	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT007064	hsa-miR-182-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22848417
MIRT007064	hsa-miR-182-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22848417
MIRT007217	hsa-miR-206	Luciferase reporter assay	23348698
MIRT018710	hsa-miR-335-5p	Microarray	18185580
MIRT026074	hsa-miR-196a-5p	Sequencing	20371350
MIRT031274	hsa-miR-19b-3p	Sequencing	20371350
MIRT003431	hsa-miR-16-5p	Sequencing	20371350
MIRT007217	hsa-miR-206	Luciferase reporter assay	23466356
MIRT007217	hsa-miR-206	Luciferase reporter assay	23466356
MIRT007217	hsa-miR-206	Luciferase reporter assay	23466356
MIRT007217	hsa-miR-206	Luciferase reporter assay	23466356
MIRT000285	hsa-miR-15a-5p	CLASH	23622248
MIRT005848	hsa-miR-17-5p	CLASH	23622248
MIRT044790	hsa-miR-320a	CLASH	23622248
MIRT044222	hsa-miR-301a-3p	CLASH	23622248
MIRT043920	hsa-miR-378a-3p	CLASH	23622248
MIRT043702	hsa-miR-342-3p	CLASH	23622248
MIRT042861	hsa-miR-324-3p	CLASH	23622248
MIRT040184	hsa-miR-615-3p	CLASH	23622248
MIRT038097	hsa-miR-423-5p	CLASH	23622248
MIRT037251	hsa-miR-877-5p	CLASH	23622248
MIRT036978	hsa-miR-877-3p	CLASH	23622248
MIRT053398	hsa-miR-96-5p	Microarray	23807165
MIRT053579	hsa-miR-29a-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053579	hsa-miR-29a-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053581	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053581	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053582	hsa-miR-29c-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053582	hsa-miR-29c-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT003835	hsa-let-7b-5p	Immunohistochemistry, Luciferase reporter assay, QRTPCR, Western blot	23482325
MIRT054149	hsa-miR-663b	Microarray, qRT-PCR	22660396
MIRT054162	hsa-miR-191-5p	Immunoprecipitation, In situ hybridization, Luciferase assay, Microarray, Northern blot, QRTPCR, Western blot	23505378
MIRT054891	hsa-miR-30c-5p	Luciferase reporter assay, Western blot	23318178
MIRT054911	hsa-miR-603	Immunoblot, Luciferase reporter assay, qRT-PCR	23384558
MIRT054911	hsa-miR-603	Immunoblot, Luciferase reporter assay, qRT-PCR	23384558
MIRT054918	hsa-miR-124-3p	Luciferase reporter assay, Western blot	23404119
MIRT053579	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT053579	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT053579	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT053579	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT438119	hsa-miR-154-5p	Luciferase reporter assay	23428540
MIRT438119	hsa-miR-154-5p	Luciferase reporter assay	23428540
MIRT186437	hsa-miR-3976	HITS-CLIP	23824327
MIRT659704	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT186437	hsa-miR-3976	HITS-CLIP	23824327
MIRT659704	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT064748	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT064752	hsa-miR-4275	PAR-CLIP	20371350
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT064753	hsa-miR-548aw	PAR-CLIP	20371350
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	20371350
MIRT134707	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT064740	hsa-miR-1297	PAR-CLIP	20371350
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT064743	hsa-miR-4465	PAR-CLIP	20371350
MIRT524551	hsa-miR-5697	PAR-CLIP	20371350
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	20371350
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	20371350
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT064748	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT064752	hsa-miR-4275	PAR-CLIP	20371350
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT064753	hsa-miR-548aw	PAR-CLIP	20371350
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	20371350
MIRT134707	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT003431	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT064691	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT064690	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT064698	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT064688	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT000285	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT064689	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT064687	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT548991	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT064700	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT113097	hsa-miR-5692a	PAR-CLIP	20371350
MIRT113092	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT113087	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT064692	hsa-miR-646	PAR-CLIP	20371350
MIRT113093	hsa-miR-3163	PAR-CLIP	20371350
MIRT113098	hsa-miR-5692b	PAR-CLIP	20371350
MIRT113096	hsa-miR-5692c	PAR-CLIP	20371350
MIRT248051	hsa-miR-8064	PAR-CLIP	20371350
MIRT064694	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT064695	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT064740	hsa-miR-1297	PAR-CLIP	20371350
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT064743	hsa-miR-4465	PAR-CLIP	20371350
MIRT064741	hsa-miR-3125	PAR-CLIP	20371350
MIRT064742	hsa-miR-3916	PAR-CLIP	20371350
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT524551	hsa-miR-5697	PAR-CLIP	20371350
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT337451	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT337453	hsa-miR-4306	PAR-CLIP	20371350
MIRT337455	hsa-miR-4644	PAR-CLIP	20371350
MIRT548996	hsa-miR-5192	PAR-CLIP	20371350
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT064748	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT064752	hsa-miR-4275	PAR-CLIP	21572407
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT064753	hsa-miR-548aw	PAR-CLIP	21572407
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	21572407
MIRT134707	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT003431	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT064691	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT064690	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT064698	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT064688	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT000285	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT064689	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT064687	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT548991	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT064700	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT113097	hsa-miR-5692a	PAR-CLIP	21572407
MIRT113092	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT113087	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT186459	hsa-miR-890	PAR-CLIP	21572407
MIRT064692	hsa-miR-646	PAR-CLIP	21572407
MIRT186466	hsa-miR-8083	PAR-CLIP	21572407
MIRT113093	hsa-miR-3163	PAR-CLIP	21572407
MIRT113098	hsa-miR-5692b	PAR-CLIP	21572407
MIRT113096	hsa-miR-5692c	PAR-CLIP	21572407
MIRT113091	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT186461	hsa-miR-4436a	PAR-CLIP	21572407
MIRT186464	hsa-miR-5000-3p	PAR-CLIP	21572407
MIRT113090	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT558895	hsa-miR-138-1-3p	PAR-CLIP	21572407
MIRT248051	hsa-miR-8064	PAR-CLIP	21572407
MIRT186465	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT064694	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT064695	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT134915	hsa-miR-6505-5p	PAR-CLIP	21572407
MIRT186462	hsa-miR-4503	PAR-CLIP	21572407
MIRT064773	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT064770	hsa-miR-4428	PAR-CLIP	21572407
MIRT558894	hsa-miR-3173-3p	PAR-CLIP	21572407
MIRT558893	hsa-miR-6891-5p	PAR-CLIP	21572407
MIRT064774	hsa-miR-8063	PAR-CLIP	21572407
MIRT064764	hsa-miR-665	PAR-CLIP	21572407
MIRT558892	hsa-miR-1237-3p	PAR-CLIP	21572407
MIRT558891	hsa-miR-1248	PAR-CLIP	21572407
MIRT064772	hsa-miR-4521	PAR-CLIP	21572407
MIRT064762	hsa-miR-610	PAR-CLIP	21572407
MIRT064769	hsa-miR-3616-3p	PAR-CLIP	21572407
MIRT558890	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT064763	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT558889	hsa-miR-6868-3p	PAR-CLIP	21572407
MIRT064740	hsa-miR-1297	PAR-CLIP	21572407
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT064743	hsa-miR-4465	PAR-CLIP	21572407
MIRT064741	hsa-miR-3125	PAR-CLIP	21572407
MIRT064742	hsa-miR-3916	PAR-CLIP	21572407
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	21572407
MIRT524551	hsa-miR-5697	PAR-CLIP	21572407
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	21572407
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	21572407
MIRT337451	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT337453	hsa-miR-4306	PAR-CLIP	21572407
MIRT337455	hsa-miR-4644	PAR-CLIP	21572407
MIRT548996	hsa-miR-5192	PAR-CLIP	21572407
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT064748	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT064752	hsa-miR-4275	PAR-CLIP	21572407
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT064753	hsa-miR-548aw	PAR-CLIP	21572407
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	21572407
MIRT134707	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT548995	hsa-miR-541-5p	PAR-CLIP	21572407
MIRT186458	hsa-miR-2392	PAR-CLIP	21572407
MIRT064758	hsa-miR-3134	PAR-CLIP	21572407
MIRT064760	hsa-miR-6744-5p	PAR-CLIP	21572407
MIRT548994	hsa-miR-1255a	PAR-CLIP	21572407
MIRT548993	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT548992	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT548991	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT064700	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT113097	hsa-miR-5692a	PAR-CLIP	21572407
MIRT113092	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT113087	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT186459	hsa-miR-890	PAR-CLIP	21572407
MIRT186466	hsa-miR-8083	PAR-CLIP	21572407
MIRT113093	hsa-miR-3163	PAR-CLIP	21572407
MIRT113098	hsa-miR-5692b	PAR-CLIP	21572407
MIRT113096	hsa-miR-5692c	PAR-CLIP	21572407
MIRT113091	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT186461	hsa-miR-4436a	PAR-CLIP	21572407
MIRT186464	hsa-miR-5000-3p	PAR-CLIP	21572407
MIRT113090	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT186465	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT134915	hsa-miR-6505-5p	PAR-CLIP	21572407
MIRT186462	hsa-miR-4503	PAR-CLIP	21572407
MIRT064740	hsa-miR-1297	PAR-CLIP	22012620
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT064743	hsa-miR-4465	PAR-CLIP	22012620
MIRT064741	hsa-miR-3125	PAR-CLIP	22012620
MIRT064742	hsa-miR-3916	PAR-CLIP	22012620
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	22012620
MIRT524551	hsa-miR-5697	PAR-CLIP	22012620
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	22012620
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	22012620
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	22012620
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	22012620
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT064748	hsa-miR-382-5p	PAR-CLIP	22012620
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	22012620
MIRT064703	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT064752	hsa-miR-4275	PAR-CLIP	22012620
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	22012620
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	22012620
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	22012620
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	22012620
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT064753	hsa-miR-548aw	PAR-CLIP	22012620
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	22012620
MIRT134707	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT064717	hsa-miR-520e	PAR-CLIP	22012620
MIRT064733	hsa-miR-302e	PAR-CLIP	22012620
MIRT064720	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT064723	hsa-miR-520b	PAR-CLIP	22012620
MIRT005673	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT064712	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT064724	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT064714	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT064726	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT064710	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT003555	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT064713	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT064729	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT064722	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT064719	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT134746	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT134754	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT044222	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT134793	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT134843	hsa-miR-3666	PAR-CLIP	22012620
MIRT134830	hsa-miR-4295	PAR-CLIP	22012620
MIRT134787	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT134829	hsa-miR-3200-5p	PAR-CLIP	22012620
MIRT134929	hsa-miR-6765-3p	PAR-CLIP	22012620
MIRT134920	hsa-miR-6730-3p	PAR-CLIP	22012620
MIRT134908	hsa-miR-1199-5p	PAR-CLIP	22012620
MIRT134924	hsa-miR-6751-3p	PAR-CLIP	22012620
MIRT538677	hsa-miR-2114-3p	PAR-CLIP	22012620
MIRT538676	hsa-miR-6823-3p	PAR-CLIP	22012620
MIRT134756	hsa-miR-378a-5p	PAR-CLIP	22012620
MIRT538675	hsa-miR-1200	PAR-CLIP	22012620
MIRT134832	hsa-miR-4303	PAR-CLIP	22012620
MIRT134808	hsa-miR-1263	PAR-CLIP	22012620
MIRT538674	hsa-miR-3074-5p	PAR-CLIP	22012620
MIRT538673	hsa-miR-7152-5p	PAR-CLIP	22012620
MIRT064740	hsa-miR-1297	PAR-CLIP	23446348
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	23446348
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	23446348
MIRT064743	hsa-miR-4465	PAR-CLIP	23446348
MIRT064741	hsa-miR-3125	PAR-CLIP	23446348
MIRT064742	hsa-miR-3916	PAR-CLIP	23446348
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT524551	hsa-miR-5697	PAR-CLIP	23446348
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	23446348
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	23446348
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	23446348
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	23592263
MIRT064703	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT064752	hsa-miR-4275	PAR-CLIP	23592263
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT064763	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT064753	hsa-miR-548aw	PAR-CLIP	23592263
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT053579	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT053581	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT053582	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT134892	hsa-miR-4779	PAR-CLIP	23592263
MIRT134927	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT134947	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT134811	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT134931	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT461351	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT134855	hsa-miR-4419a	PAR-CLIP	23592263
MIRT134868	hsa-miR-4510	PAR-CLIP	23592263
MIRT134910	hsa-miR-6127	PAR-CLIP	23592263
MIRT134911	hsa-miR-6129	PAR-CLIP	23592263
MIRT134912	hsa-miR-6130	PAR-CLIP	23592263
MIRT134913	hsa-miR-6133	PAR-CLIP	23592263
MIRT134945	hsa-miR-6828-5p	PAR-CLIP	23592263
MIRT134857	hsa-miR-4434	PAR-CLIP	23592263
MIRT134869	hsa-miR-4516	PAR-CLIP	23592263
MIRT134907	hsa-miR-5703	PAR-CLIP	23592263
MIRT134805	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT134939	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT134955	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT461350	hsa-miR-3672	PAR-CLIP	23592263
MIRT461349	hsa-miR-6864-3p	PAR-CLIP	23592263
MIRT134791	hsa-miR-765	PAR-CLIP	23592263
MIRT134758	hsa-miR-340-3p	PAR-CLIP	22100165
MIRT134944	hsa-miR-6827-3p	PAR-CLIP	22100165
MIRT443729	hsa-miR-6501-5p	PAR-CLIP	22100165
MIRT443728	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT232223	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT064747	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT031274	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT134736	hsa-miR-98-5p	GFP reporter assay	26840039
MIRT548991	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	25817794
MIRT548991	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	25817794
MIRT053581	hsa-miR-29b-3p	qRT-PCR, Western blot	26393798
MIRT005478	hsa-let-7a-5p	qRT-PCR, Western blot	26393798
MIRT003431	hsa-miR-16-5p	qRT-PCR, Western blot	26393798
MIRT053581	hsa-miR-29b-3p	qRT-PCR, Western blot	26393798
MIRT732948	hsa-miR-574-3p	EMSA, Luciferase reporter assay, qRT-PCR, Western blotting	31729531
MIRT064736	hsa-miR-26b-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	34096637
MIRT186437	hsa-miR-3976	HITS-CLIP	23824327
MIRT659704	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT186437	hsa-miR-3976	HITS-CLIP	23824327
MIRT659704	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT064748	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT064752	hsa-miR-4275	PAR-CLIP	20371350
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT064753	hsa-miR-548aw	PAR-CLIP	20371350
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	20371350
MIRT134707	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT064740	hsa-miR-1297	PAR-CLIP	20371350
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT064743	hsa-miR-4465	PAR-CLIP	20371350
MIRT524551	hsa-miR-5697	PAR-CLIP	20371350
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	20371350
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	20371350
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT064748	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT064752	hsa-miR-4275	PAR-CLIP	20371350
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT064753	hsa-miR-548aw	PAR-CLIP	20371350
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	20371350
MIRT134707	hsa-miR-744-3p	PAR-CLIP	20371350
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT003431	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT064691	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT064690	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT064698	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT064688	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT000285	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT064689	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT064687	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT548991	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT064700	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT113097	hsa-miR-5692a	PAR-CLIP	20371350
MIRT113092	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT113087	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT064692	hsa-miR-646	PAR-CLIP	20371350
MIRT113093	hsa-miR-3163	PAR-CLIP	20371350
MIRT113098	hsa-miR-5692b	PAR-CLIP	20371350
MIRT113096	hsa-miR-5692c	PAR-CLIP	20371350
MIRT248051	hsa-miR-8064	PAR-CLIP	20371350
MIRT064694	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT064695	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT064740	hsa-miR-1297	PAR-CLIP	20371350
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT064743	hsa-miR-4465	PAR-CLIP	20371350
MIRT064741	hsa-miR-3125	PAR-CLIP	20371350
MIRT064742	hsa-miR-3916	PAR-CLIP	20371350
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT524551	hsa-miR-5697	PAR-CLIP	20371350
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT337451	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT337453	hsa-miR-4306	PAR-CLIP	20371350
MIRT337455	hsa-miR-4644	PAR-CLIP	20371350
MIRT548996	hsa-miR-5192	PAR-CLIP	20371350
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT064748	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT064752	hsa-miR-4275	PAR-CLIP	21572407
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT064753	hsa-miR-548aw	PAR-CLIP	21572407
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	21572407
MIRT134707	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT003431	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT064691	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT064690	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT064698	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT064688	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT000285	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT064689	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT064687	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT548991	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT064700	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT113097	hsa-miR-5692a	PAR-CLIP	21572407
MIRT113092	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT113087	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT186459	hsa-miR-890	PAR-CLIP	21572407
MIRT064692	hsa-miR-646	PAR-CLIP	21572407
MIRT186466	hsa-miR-8083	PAR-CLIP	21572407
MIRT113093	hsa-miR-3163	PAR-CLIP	21572407
MIRT113098	hsa-miR-5692b	PAR-CLIP	21572407
MIRT113096	hsa-miR-5692c	PAR-CLIP	21572407
MIRT113091	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT186461	hsa-miR-4436a	PAR-CLIP	21572407
MIRT186464	hsa-miR-5000-3p	PAR-CLIP	21572407
MIRT113090	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT558895	hsa-miR-138-1-3p	PAR-CLIP	21572407
MIRT248051	hsa-miR-8064	PAR-CLIP	21572407
MIRT186465	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT064694	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT064695	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT134915	hsa-miR-6505-5p	PAR-CLIP	21572407
MIRT186462	hsa-miR-4503	PAR-CLIP	21572407
MIRT064773	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT064770	hsa-miR-4428	PAR-CLIP	21572407
MIRT558894	hsa-miR-3173-3p	PAR-CLIP	21572407
MIRT558893	hsa-miR-6891-5p	PAR-CLIP	21572407
MIRT064774	hsa-miR-8063	PAR-CLIP	21572407
MIRT064764	hsa-miR-665	PAR-CLIP	21572407
MIRT558892	hsa-miR-1237-3p	PAR-CLIP	21572407
MIRT558891	hsa-miR-1248	PAR-CLIP	21572407
MIRT064772	hsa-miR-4521	PAR-CLIP	21572407
MIRT064762	hsa-miR-610	PAR-CLIP	21572407
MIRT064769	hsa-miR-3616-3p	PAR-CLIP	21572407
MIRT558890	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT064763	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT558889	hsa-miR-6868-3p	PAR-CLIP	21572407
MIRT064740	hsa-miR-1297	PAR-CLIP	21572407
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT064743	hsa-miR-4465	PAR-CLIP	21572407
MIRT064741	hsa-miR-3125	PAR-CLIP	21572407
MIRT064742	hsa-miR-3916	PAR-CLIP	21572407
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	21572407
MIRT524551	hsa-miR-5697	PAR-CLIP	21572407
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	21572407
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	21572407
MIRT337451	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT337453	hsa-miR-4306	PAR-CLIP	21572407
MIRT337455	hsa-miR-4644	PAR-CLIP	21572407
MIRT548996	hsa-miR-5192	PAR-CLIP	21572407
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT064748	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	21572407
MIRT064752	hsa-miR-4275	PAR-CLIP	21572407
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT064753	hsa-miR-548aw	PAR-CLIP	21572407
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	21572407
MIRT134707	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT548995	hsa-miR-541-5p	PAR-CLIP	21572407
MIRT186458	hsa-miR-2392	PAR-CLIP	21572407
MIRT064758	hsa-miR-3134	PAR-CLIP	21572407
MIRT064760	hsa-miR-6744-5p	PAR-CLIP	21572407
MIRT548994	hsa-miR-1255a	PAR-CLIP	21572407
MIRT548993	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT548992	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT548991	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT064700	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT113097	hsa-miR-5692a	PAR-CLIP	21572407
MIRT113092	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT113087	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT186459	hsa-miR-890	PAR-CLIP	21572407
MIRT186466	hsa-miR-8083	PAR-CLIP	21572407
MIRT113093	hsa-miR-3163	PAR-CLIP	21572407
MIRT113098	hsa-miR-5692b	PAR-CLIP	21572407
MIRT113096	hsa-miR-5692c	PAR-CLIP	21572407
MIRT113091	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT186461	hsa-miR-4436a	PAR-CLIP	21572407
MIRT186464	hsa-miR-5000-3p	PAR-CLIP	21572407
MIRT113090	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT186465	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT134915	hsa-miR-6505-5p	PAR-CLIP	21572407
MIRT186462	hsa-miR-4503	PAR-CLIP	21572407
MIRT064740	hsa-miR-1297	PAR-CLIP	22012620
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT064743	hsa-miR-4465	PAR-CLIP	22012620
MIRT064741	hsa-miR-3125	PAR-CLIP	22012620
MIRT064742	hsa-miR-3916	PAR-CLIP	22012620
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	22012620
MIRT524551	hsa-miR-5697	PAR-CLIP	22012620
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	22012620
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	22012620
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	22012620
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	22012620
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT064748	hsa-miR-382-5p	PAR-CLIP	22012620
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	22012620
MIRT064703	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT064752	hsa-miR-4275	PAR-CLIP	22012620
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	22012620
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	22012620
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	22012620
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	22012620
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT064753	hsa-miR-548aw	PAR-CLIP	22012620
MIRT538678	hsa-miR-6772-3p	PAR-CLIP	22012620
MIRT134707	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT064717	hsa-miR-520e	PAR-CLIP	22012620
MIRT064733	hsa-miR-302e	PAR-CLIP	22012620
MIRT064720	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT064723	hsa-miR-520b	PAR-CLIP	22012620
MIRT005673	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT064712	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT064724	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT064714	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT064726	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT064710	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT003555	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT064713	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	22012620
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	22012620
MIRT064729	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT064722	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT064719	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT134746	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT134754	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT044222	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT134793	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT134843	hsa-miR-3666	PAR-CLIP	22012620
MIRT134830	hsa-miR-4295	PAR-CLIP	22012620
MIRT134787	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT134829	hsa-miR-3200-5p	PAR-CLIP	22012620
MIRT134929	hsa-miR-6765-3p	PAR-CLIP	22012620
MIRT134920	hsa-miR-6730-3p	PAR-CLIP	22012620
MIRT134908	hsa-miR-1199-5p	PAR-CLIP	22012620
MIRT134924	hsa-miR-6751-3p	PAR-CLIP	22012620
MIRT538677	hsa-miR-2114-3p	PAR-CLIP	22012620
MIRT538676	hsa-miR-6823-3p	PAR-CLIP	22012620
MIRT134756	hsa-miR-378a-5p	PAR-CLIP	22012620
MIRT538675	hsa-miR-1200	PAR-CLIP	22012620
MIRT134832	hsa-miR-4303	PAR-CLIP	22012620
MIRT134808	hsa-miR-1263	PAR-CLIP	22012620
MIRT538674	hsa-miR-3074-5p	PAR-CLIP	22012620
MIRT538673	hsa-miR-7152-5p	PAR-CLIP	22012620
MIRT064740	hsa-miR-1297	PAR-CLIP	23446348
MIRT000112	hsa-miR-26a-5p	PAR-CLIP	23446348
MIRT064736	hsa-miR-26b-5p	PAR-CLIP	23446348
MIRT064743	hsa-miR-4465	PAR-CLIP	23446348
MIRT064741	hsa-miR-3125	PAR-CLIP	23446348
MIRT064742	hsa-miR-3916	PAR-CLIP	23446348
MIRT064746	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT524551	hsa-miR-5697	PAR-CLIP	23446348
MIRT064744	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT524550	hsa-miR-2682-3p	PAR-CLIP	23446348
MIRT524549	hsa-miR-6781-3p	PAR-CLIP	23446348
MIRT064705	hsa-miR-3653-3p	PAR-CLIP	23446348
MIRT064747	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT031274	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT064755	hsa-miR-7849-3p	PAR-CLIP	23592263
MIRT064703	hsa-miR-3613-3p	PAR-CLIP	23592263
MIRT064752	hsa-miR-4275	PAR-CLIP	23592263
MIRT064771	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT064765	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT064766	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT064767	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT064763	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT064753	hsa-miR-548aw	PAR-CLIP	23592263
MIRT134874	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT053579	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT053581	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT053582	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT134892	hsa-miR-4779	PAR-CLIP	23592263
MIRT134927	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT134947	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT134811	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT134931	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT461351	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT134855	hsa-miR-4419a	PAR-CLIP	23592263
MIRT134868	hsa-miR-4510	PAR-CLIP	23592263
MIRT134910	hsa-miR-6127	PAR-CLIP	23592263
MIRT134911	hsa-miR-6129	PAR-CLIP	23592263
MIRT134912	hsa-miR-6130	PAR-CLIP	23592263
MIRT134913	hsa-miR-6133	PAR-CLIP	23592263
MIRT134945	hsa-miR-6828-5p	PAR-CLIP	23592263
MIRT134857	hsa-miR-4434	PAR-CLIP	23592263
MIRT134869	hsa-miR-4516	PAR-CLIP	23592263
MIRT134907	hsa-miR-5703	PAR-CLIP	23592263
MIRT134805	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT134939	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT134955	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT461350	hsa-miR-3672	PAR-CLIP	23592263
MIRT461349	hsa-miR-6864-3p	PAR-CLIP	23592263
MIRT134791	hsa-miR-765	PAR-CLIP	23592263
MIRT134758	hsa-miR-340-3p	PAR-CLIP	22100165
MIRT134944	hsa-miR-6827-3p	PAR-CLIP	22100165
MIRT443729	hsa-miR-6501-5p	PAR-CLIP	22100165
MIRT443728	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT232223	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT000285	hsa-miR-15a-5p	Microarray, qRT-PCR	35816043
MIRT756417	hsa-miR-93-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35306579
MIRT871691	hsa-miR-1	CLIP-seq
MIRT871692	hsa-miR-1183	CLIP-seq
MIRT871693	hsa-miR-1252	CLIP-seq
MIRT871694	hsa-miR-1321	CLIP-seq
MIRT871695	hsa-miR-135a	CLIP-seq
MIRT871696	hsa-miR-135b	CLIP-seq
MIRT871697	hsa-miR-185	CLIP-seq
MIRT871698	hsa-miR-188-5p	CLIP-seq
MIRT871699	hsa-miR-214	CLIP-seq
MIRT871700	hsa-miR-3120-3p	CLIP-seq
MIRT871701	hsa-miR-3150b-3p	CLIP-seq
MIRT871702	hsa-miR-3179	CLIP-seq
MIRT871703	hsa-miR-3202	CLIP-seq
MIRT871704	hsa-miR-3619-5p	CLIP-seq
MIRT871705	hsa-miR-371-5p	CLIP-seq
MIRT871706	hsa-miR-371b-5p	CLIP-seq
MIRT871707	hsa-miR-3920	CLIP-seq
MIRT871708	hsa-miR-3936	CLIP-seq
MIRT871709	hsa-miR-4291	CLIP-seq
MIRT871710	hsa-miR-4476	CLIP-seq
MIRT871711	hsa-miR-451b	CLIP-seq
MIRT871712	hsa-miR-4643	CLIP-seq
MIRT871713	hsa-miR-4649-3p	CLIP-seq
MIRT871714	hsa-miR-466	CLIP-seq
MIRT871715	hsa-miR-4661-3p	CLIP-seq
MIRT871716	hsa-miR-4728-5p	CLIP-seq
MIRT871717	hsa-miR-4739	CLIP-seq
MIRT871718	hsa-miR-4756-5p	CLIP-seq
MIRT871719	hsa-miR-4762-3p	CLIP-seq
MIRT871720	hsa-miR-4780	CLIP-seq
MIRT871721	hsa-miR-4784	CLIP-seq
MIRT871722	hsa-miR-4789-3p	CLIP-seq
MIRT871723	hsa-miR-495	CLIP-seq
MIRT871724	hsa-miR-513c	CLIP-seq
MIRT871725	hsa-miR-514b-5p	CLIP-seq
MIRT871726	hsa-miR-548v	CLIP-seq
MIRT871727	hsa-miR-613	CLIP-seq
MIRT871728	hsa-miR-623	CLIP-seq
MIRT871729	hsa-miR-628-5p	CLIP-seq
MIRT871730	hsa-miR-659	CLIP-seq
MIRT871731	hsa-miR-761	CLIP-seq
MIRT871732	hsa-miR-922	CLIP-seq
MIRT871702	hsa-miR-3179	CLIP-seq
MIRT871728	hsa-miR-623	CLIP-seq
MIRT1958702	hsa-miR-1231	CLIP-seq
MIRT1958703	hsa-miR-1253	CLIP-seq
MIRT871694	hsa-miR-1321	CLIP-seq
MIRT1958704	hsa-miR-149	CLIP-seq
MIRT871697	hsa-miR-185	CLIP-seq
MIRT1958705	hsa-miR-296-3p	CLIP-seq
MIRT1958706	hsa-miR-3064-5p	CLIP-seq
MIRT1958707	hsa-miR-3119	CLIP-seq
MIRT1958708	hsa-miR-3133	CLIP-seq
MIRT1958709	hsa-miR-3166	CLIP-seq
MIRT1958710	hsa-miR-3182	CLIP-seq
MIRT871703	hsa-miR-3202	CLIP-seq
MIRT1958711	hsa-miR-323b-5p	CLIP-seq
MIRT1958712	hsa-miR-3653	CLIP-seq
MIRT1958713	hsa-miR-3686	CLIP-seq
MIRT1958714	hsa-miR-3915	CLIP-seq
MIRT1958715	hsa-miR-3928	CLIP-seq
MIRT1958716	hsa-miR-4279	CLIP-seq
MIRT1958717	hsa-miR-4288	CLIP-seq
MIRT1958718	hsa-miR-4310	CLIP-seq
MIRT1958719	hsa-miR-4311	CLIP-seq
MIRT1958720	hsa-miR-4438	CLIP-seq
MIRT871713	hsa-miR-4649-3p	CLIP-seq
MIRT871716	hsa-miR-4728-5p	CLIP-seq
MIRT871717	hsa-miR-4739	CLIP-seq
MIRT1958721	hsa-miR-4742-3p	CLIP-seq
MIRT871718	hsa-miR-4756-5p	CLIP-seq
MIRT1958722	hsa-miR-4761-5p	CLIP-seq
MIRT1958723	hsa-miR-4794	CLIP-seq
MIRT1958724	hsa-miR-511	CLIP-seq
MIRT1958725	hsa-miR-630	CLIP-seq
MIRT1958726	hsa-miR-632	CLIP-seq
MIRT1958727	hsa-miR-942	CLIP-seq
MIRT2195435	hsa-miR-103b	CLIP-seq
MIRT2195436	hsa-miR-2681	CLIP-seq
MIRT2195437	hsa-miR-3074-3p	CLIP-seq
MIRT2195438	hsa-miR-4646-3p	CLIP-seq
MIRT2195439	hsa-miR-4712-5p	CLIP-seq
MIRT2195440	hsa-miR-643	CLIP-seq
MIRT2195441	hsa-miR-770-5p	CLIP-seq
MIRT871697	hsa-miR-185	CLIP-seq
MIRT871700	hsa-miR-3120-3p	CLIP-seq
MIRT871692	hsa-miR-1183	CLIP-seq
MIRT2436138	hsa-miR-1205	CLIP-seq
MIRT2436139	hsa-miR-1228	CLIP-seq
MIRT2436140	hsa-miR-1261	CLIP-seq
MIRT2436141	hsa-miR-130a	CLIP-seq
MIRT2436142	hsa-miR-130b	CLIP-seq
MIRT2436143	hsa-miR-146b-3p	CLIP-seq
MIRT2436144	hsa-miR-150	CLIP-seq
MIRT2436145	hsa-miR-183	CLIP-seq
MIRT2436146	hsa-miR-18a	CLIP-seq
MIRT2436147	hsa-miR-18b	CLIP-seq
MIRT2436148	hsa-miR-190	CLIP-seq
MIRT2436149	hsa-miR-190b	CLIP-seq
MIRT2436150	hsa-miR-19a	CLIP-seq
MIRT2436151	hsa-miR-19b	CLIP-seq
MIRT2436152	hsa-miR-301a	CLIP-seq
MIRT2436153	hsa-miR-301b	CLIP-seq
MIRT2436154	hsa-miR-302a	CLIP-seq
MIRT2436155	hsa-miR-302b	CLIP-seq
MIRT2436156	hsa-miR-302c	CLIP-seq
MIRT2436157	hsa-miR-302d	CLIP-seq
MIRT2436158	hsa-miR-3123	CLIP-seq
MIRT2436159	hsa-miR-3617	CLIP-seq
MIRT2436160	hsa-miR-372	CLIP-seq
MIRT2436161	hsa-miR-373	CLIP-seq
MIRT2436162	hsa-miR-454	CLIP-seq
MIRT2436163	hsa-miR-4677-3p	CLIP-seq
MIRT2436164	hsa-miR-4735-3p	CLIP-seq
MIRT2436165	hsa-miR-4756-3p	CLIP-seq
MIRT2436166	hsa-miR-4802-3p	CLIP-seq
MIRT2436167	hsa-miR-519a	CLIP-seq
MIRT2436168	hsa-miR-522	CLIP-seq
MIRT2436169	hsa-miR-526b	CLIP-seq
MIRT2436170	hsa-miR-641	CLIP-seq
MIRT871692	hsa-miR-1183	CLIP-seq
MIRT2436139	hsa-miR-1228	CLIP-seq
MIRT2436140	hsa-miR-1261	CLIP-seq
MIRT2436159	hsa-miR-3617	CLIP-seq
MIRT2436163	hsa-miR-4677-3p	CLIP-seq
MIRT2436170	hsa-miR-641	CLIP-seq
MIRT2498776	hsa-let-7a	CLIP-seq
MIRT2498777	hsa-let-7b	CLIP-seq
MIRT2498778	hsa-let-7c	CLIP-seq
MIRT2498779	hsa-let-7d	CLIP-seq
MIRT2498780	hsa-let-7e	CLIP-seq
MIRT2498781	hsa-let-7f	CLIP-seq
MIRT2498782	hsa-let-7g	CLIP-seq
MIRT2498783	hsa-let-7i	CLIP-seq
MIRT2195435	hsa-miR-103b	CLIP-seq
MIRT871692	hsa-miR-1183	CLIP-seq
MIRT2498784	hsa-miR-1184	CLIP-seq
MIRT2436138	hsa-miR-1205	CLIP-seq
MIRT2436139	hsa-miR-1228	CLIP-seq
MIRT2498785	hsa-miR-124	CLIP-seq
MIRT2436140	hsa-miR-1261	CLIP-seq
MIRT2498786	hsa-miR-1294	CLIP-seq
MIRT2498787	hsa-miR-129-5p	CLIP-seq
MIRT2498788	hsa-miR-1299	CLIP-seq
MIRT2498789	hsa-miR-1301	CLIP-seq
MIRT2436141	hsa-miR-130a	CLIP-seq
MIRT2436142	hsa-miR-130b	CLIP-seq
MIRT871694	hsa-miR-1321	CLIP-seq
MIRT2498790	hsa-miR-1323	CLIP-seq
MIRT871695	hsa-miR-135a	CLIP-seq
MIRT871696	hsa-miR-135b	CLIP-seq
MIRT2498791	hsa-miR-139-5p	CLIP-seq
MIRT2498792	hsa-miR-141	CLIP-seq
MIRT2436144	hsa-miR-150	CLIP-seq
MIRT2498793	hsa-miR-1538	CLIP-seq
MIRT2498794	hsa-miR-1825	CLIP-seq
MIRT2498795	hsa-miR-1827	CLIP-seq
MIRT2436145	hsa-miR-183	CLIP-seq
MIRT871697	hsa-miR-185	CLIP-seq
MIRT871698	hsa-miR-188-5p	CLIP-seq
MIRT2436148	hsa-miR-190	CLIP-seq
MIRT2436149	hsa-miR-190b	CLIP-seq
MIRT2498796	hsa-miR-192	CLIP-seq
MIRT2498797	hsa-miR-199a-3p	CLIP-seq
MIRT2498798	hsa-miR-199a-5p	CLIP-seq
MIRT2498799	hsa-miR-199b-3p	CLIP-seq
MIRT2498800	hsa-miR-199b-5p	CLIP-seq
MIRT2436150	hsa-miR-19a	CLIP-seq
MIRT2436151	hsa-miR-19b	CLIP-seq
MIRT2498801	hsa-miR-200a	CLIP-seq
MIRT2498802	hsa-miR-202	CLIP-seq
MIRT2498803	hsa-miR-215	CLIP-seq
MIRT2498804	hsa-miR-2355-5p	CLIP-seq
MIRT2195436	hsa-miR-2681	CLIP-seq
MIRT2498805	hsa-miR-2682	CLIP-seq
MIRT2436152	hsa-miR-301a	CLIP-seq
MIRT2436153	hsa-miR-301b	CLIP-seq
MIRT2436154	hsa-miR-302a	CLIP-seq
MIRT2436155	hsa-miR-302b	CLIP-seq
MIRT2436156	hsa-miR-302c	CLIP-seq
MIRT2436157	hsa-miR-302d	CLIP-seq
MIRT2195437	hsa-miR-3074-3p	CLIP-seq
MIRT871700	hsa-miR-3120-3p	CLIP-seq
MIRT2436158	hsa-miR-3123	CLIP-seq
MIRT2498806	hsa-miR-3127-3p	CLIP-seq
MIRT2498807	hsa-miR-3129-5p	CLIP-seq
MIRT2498808	hsa-miR-3130-5p	CLIP-seq
MIRT2498809	hsa-miR-3137	CLIP-seq
MIRT2498810	hsa-miR-3148	CLIP-seq
MIRT871701	hsa-miR-3150b-3p	CLIP-seq
MIRT2498811	hsa-miR-3173-5p	CLIP-seq
MIRT871702	hsa-miR-3179	CLIP-seq
MIRT1958710	hsa-miR-3182	CLIP-seq
MIRT2498812	hsa-miR-3187-3p	CLIP-seq
MIRT2498813	hsa-miR-323b-3p	CLIP-seq
MIRT2498814	hsa-miR-346	CLIP-seq
MIRT2436159	hsa-miR-3617	CLIP-seq
MIRT2498815	hsa-miR-3622a-3p	CLIP-seq
MIRT2498816	hsa-miR-3622b-3p	CLIP-seq
MIRT1958712	hsa-miR-3653	CLIP-seq
MIRT2498817	hsa-miR-3658	CLIP-seq
MIRT2498818	hsa-miR-3667-5p	CLIP-seq
MIRT2498819	hsa-miR-3674	CLIP-seq
MIRT2498820	hsa-miR-3679-3p	CLIP-seq
MIRT1958713	hsa-miR-3686	CLIP-seq
MIRT2498821	hsa-miR-3688-3p	CLIP-seq
MIRT2498822	hsa-miR-3690	CLIP-seq
MIRT2498823	hsa-miR-3714	CLIP-seq
MIRT871705	hsa-miR-371-5p	CLIP-seq
MIRT871706	hsa-miR-371b-5p	CLIP-seq
MIRT2436160	hsa-miR-372	CLIP-seq
MIRT2436161	hsa-miR-373	CLIP-seq
MIRT2498824	hsa-miR-3910	CLIP-seq
MIRT2498825	hsa-miR-3919	CLIP-seq
MIRT2498826	hsa-miR-3925-3p	CLIP-seq
MIRT2498827	hsa-miR-3925-5p	CLIP-seq
MIRT2498828	hsa-miR-3929	CLIP-seq
MIRT2498829	hsa-miR-3973	CLIP-seq
MIRT2498830	hsa-miR-412	CLIP-seq
MIRT2498831	hsa-miR-4254	CLIP-seq
MIRT2498832	hsa-miR-4256	CLIP-seq
MIRT2498833	hsa-miR-4287	CLIP-seq
MIRT2498834	hsa-miR-4297	CLIP-seq
MIRT2498835	hsa-miR-4312	CLIP-seq
MIRT2498836	hsa-miR-4316	CLIP-seq
MIRT2498837	hsa-miR-4317	CLIP-seq
MIRT2498838	hsa-miR-4324	CLIP-seq
MIRT2498839	hsa-miR-4330	CLIP-seq
MIRT2498840	hsa-miR-4419b	CLIP-seq
MIRT2498841	hsa-miR-4422	CLIP-seq
MIRT2498842	hsa-miR-4435	CLIP-seq
MIRT2498843	hsa-miR-4437	CLIP-seq
MIRT2498844	hsa-miR-4450	CLIP-seq
MIRT2498845	hsa-miR-4458	CLIP-seq
MIRT2498846	hsa-miR-4478	CLIP-seq
MIRT2498847	hsa-miR-4482	CLIP-seq
MIRT2498848	hsa-miR-449c	CLIP-seq
MIRT2498849	hsa-miR-4500	CLIP-seq
MIRT2498850	hsa-miR-4511	CLIP-seq
MIRT2498851	hsa-miR-4530	CLIP-seq
MIRT2436162	hsa-miR-454	CLIP-seq
MIRT2498852	hsa-miR-4635	CLIP-seq
MIRT2498853	hsa-miR-4642	CLIP-seq
MIRT871712	hsa-miR-4643	CLIP-seq
MIRT871713	hsa-miR-4649-3p	CLIP-seq
MIRT2498854	hsa-miR-4659a-5p	CLIP-seq
MIRT2498855	hsa-miR-4659b-5p	CLIP-seq
MIRT871714	hsa-miR-466	CLIP-seq
MIRT2498856	hsa-miR-4660	CLIP-seq
MIRT871715	hsa-miR-4661-3p	CLIP-seq
MIRT2498857	hsa-miR-4662a-5p	CLIP-seq
MIRT2498858	hsa-miR-4667-5p	CLIP-seq
MIRT2498859	hsa-miR-4674	CLIP-seq
MIRT2436163	hsa-miR-4677-3p	CLIP-seq
MIRT2498860	hsa-miR-4678	CLIP-seq
MIRT2498861	hsa-miR-4685-3p	CLIP-seq
MIRT2498862	hsa-miR-4698	CLIP-seq
MIRT2498863	hsa-miR-4700-5p	CLIP-seq
MIRT2498864	hsa-miR-4701-5p	CLIP-seq
MIRT2498865	hsa-miR-4715-5p	CLIP-seq
MIRT2498866	hsa-miR-4724-5p	CLIP-seq
MIRT871716	hsa-miR-4728-5p	CLIP-seq
MIRT2498867	hsa-miR-4731-5p	CLIP-seq
MIRT2498868	hsa-miR-4732-5p	CLIP-seq
MIRT2498869	hsa-miR-4738-3p	CLIP-seq
MIRT871717	hsa-miR-4739	CLIP-seq
MIRT1958721	hsa-miR-4742-3p	CLIP-seq
MIRT2498870	hsa-miR-4745-3p	CLIP-seq
MIRT2498871	hsa-miR-4753-5p	CLIP-seq
MIRT2436165	hsa-miR-4756-3p	CLIP-seq
MIRT871718	hsa-miR-4756-5p	CLIP-seq
MIRT2498872	hsa-miR-4773	CLIP-seq
MIRT2498873	hsa-miR-4776-3p	CLIP-seq
MIRT2498874	hsa-miR-4778-3p	CLIP-seq
MIRT871720	hsa-miR-4780	CLIP-seq
MIRT871721	hsa-miR-4784	CLIP-seq
MIRT2498875	hsa-miR-4786-5p	CLIP-seq
MIRT871722	hsa-miR-4789-3p	CLIP-seq
MIRT2436166	hsa-miR-4802-3p	CLIP-seq
MIRT2498876	hsa-miR-4803	CLIP-seq
MIRT2498877	hsa-miR-500a	CLIP-seq
MIRT2498878	hsa-miR-501-5p	CLIP-seq
MIRT2498879	hsa-miR-5047	CLIP-seq
MIRT2498880	hsa-miR-506	CLIP-seq
MIRT2498881	hsa-miR-5096	CLIP-seq
MIRT871724	hsa-miR-513c	CLIP-seq
MIRT871725	hsa-miR-514b-5p	CLIP-seq
MIRT2436167	hsa-miR-519a	CLIP-seq
MIRT2498882	hsa-miR-544b	CLIP-seq
MIRT2498883	hsa-miR-548ac	CLIP-seq
MIRT2498884	hsa-miR-548ae	CLIP-seq
MIRT2498885	hsa-miR-548aj	CLIP-seq
MIRT2498886	hsa-miR-548am	CLIP-seq
MIRT2498887	hsa-miR-548an	CLIP-seq
MIRT2498888	hsa-miR-548b-3p	CLIP-seq
MIRT2498889	hsa-miR-548d-3p	CLIP-seq
MIRT2498890	hsa-miR-548g	CLIP-seq
MIRT2498891	hsa-miR-548o	CLIP-seq
MIRT2498892	hsa-miR-548p	CLIP-seq
MIRT2498893	hsa-miR-548s	CLIP-seq
MIRT871726	hsa-miR-548v	CLIP-seq
MIRT2498894	hsa-miR-548x	CLIP-seq
MIRT2498895	hsa-miR-548z	CLIP-seq
MIRT2498896	hsa-miR-570	CLIP-seq
MIRT2498897	hsa-miR-571	CLIP-seq
MIRT2498898	hsa-miR-577	CLIP-seq
MIRT2498899	hsa-miR-583	CLIP-seq
MIRT2498900	hsa-miR-588	CLIP-seq
MIRT2498901	hsa-miR-615-5p	CLIP-seq
MIRT871728	hsa-miR-623	CLIP-seq
MIRT871729	hsa-miR-628-5p	CLIP-seq
MIRT1958725	hsa-miR-630	CLIP-seq
MIRT2436170	hsa-miR-641	CLIP-seq
MIRT871730	hsa-miR-659	CLIP-seq
MIRT2498902	hsa-miR-7	CLIP-seq
MIRT2498903	hsa-miR-766	CLIP-seq
MIRT2498904	hsa-miR-769-5p	CLIP-seq
MIRT2498905	hsa-miR-875-3p	CLIP-seq
MIRT2498906	hsa-miR-98	CLIP-seq
MIRT2498776	hsa-let-7a	CLIP-seq
MIRT2498777	hsa-let-7b	CLIP-seq
MIRT2498778	hsa-let-7c	CLIP-seq
MIRT2498779	hsa-let-7d	CLIP-seq
MIRT2498780	hsa-let-7e	CLIP-seq
MIRT2498781	hsa-let-7f	CLIP-seq
MIRT2498782	hsa-let-7g	CLIP-seq
MIRT2498783	hsa-let-7i	CLIP-seq
MIRT2195435	hsa-miR-103b	CLIP-seq
MIRT871692	hsa-miR-1183	CLIP-seq
MIRT2498784	hsa-miR-1184	CLIP-seq
MIRT2436138	hsa-miR-1205	CLIP-seq
MIRT2436139	hsa-miR-1228	CLIP-seq
MIRT2498785	hsa-miR-124	CLIP-seq
MIRT871693	hsa-miR-1252	CLIP-seq
MIRT2436140	hsa-miR-1261	CLIP-seq
MIRT2498786	hsa-miR-1294	CLIP-seq
MIRT2498787	hsa-miR-129-5p	CLIP-seq
MIRT2498788	hsa-miR-1299	CLIP-seq
MIRT2498789	hsa-miR-1301	CLIP-seq
MIRT2436141	hsa-miR-130a	CLIP-seq
MIRT2436142	hsa-miR-130b	CLIP-seq
MIRT871694	hsa-miR-1321	CLIP-seq
MIRT2498790	hsa-miR-1323	CLIP-seq
MIRT871695	hsa-miR-135a	CLIP-seq
MIRT871696	hsa-miR-135b	CLIP-seq
MIRT2498791	hsa-miR-139-5p	CLIP-seq
MIRT2436144	hsa-miR-150	CLIP-seq
MIRT2498793	hsa-miR-1538	CLIP-seq
MIRT2498794	hsa-miR-1825	CLIP-seq
MIRT2498795	hsa-miR-1827	CLIP-seq
MIRT2436145	hsa-miR-183	CLIP-seq
MIRT871697	hsa-miR-185	CLIP-seq
MIRT871698	hsa-miR-188-5p	CLIP-seq
MIRT2436148	hsa-miR-190	CLIP-seq
MIRT2436149	hsa-miR-190b	CLIP-seq
MIRT2498796	hsa-miR-192	CLIP-seq
MIRT2498797	hsa-miR-199a-3p	CLIP-seq
MIRT2498798	hsa-miR-199a-5p	CLIP-seq
MIRT2498799	hsa-miR-199b-3p	CLIP-seq
MIRT2498800	hsa-miR-199b-5p	CLIP-seq
MIRT2436150	hsa-miR-19a	CLIP-seq
MIRT2436151	hsa-miR-19b	CLIP-seq
MIRT2498802	hsa-miR-202	CLIP-seq
MIRT2498803	hsa-miR-215	CLIP-seq
MIRT2498804	hsa-miR-2355-5p	CLIP-seq
MIRT2498805	hsa-miR-2682	CLIP-seq
MIRT2677526	hsa-miR-28-5p	CLIP-seq
MIRT2677527	hsa-miR-29a	CLIP-seq
MIRT2677528	hsa-miR-29b	CLIP-seq
MIRT2677529	hsa-miR-29c	CLIP-seq
MIRT2436152	hsa-miR-301a	CLIP-seq
MIRT2436153	hsa-miR-301b	CLIP-seq
MIRT2436154	hsa-miR-302a	CLIP-seq
MIRT2436155	hsa-miR-302b	CLIP-seq
MIRT2436156	hsa-miR-302c	CLIP-seq
MIRT2436157	hsa-miR-302d	CLIP-seq
MIRT871700	hsa-miR-3120-3p	CLIP-seq
MIRT2436158	hsa-miR-3123	CLIP-seq
MIRT2498806	hsa-miR-3127-3p	CLIP-seq
MIRT2498807	hsa-miR-3129-5p	CLIP-seq
MIRT2498808	hsa-miR-3130-5p	CLIP-seq
MIRT2498809	hsa-miR-3137	CLIP-seq
MIRT2677530	hsa-miR-3139	CLIP-seq
MIRT2498810	hsa-miR-3148	CLIP-seq
MIRT871701	hsa-miR-3150b-3p	CLIP-seq
MIRT2498811	hsa-miR-3173-5p	CLIP-seq
MIRT871702	hsa-miR-3179	CLIP-seq
MIRT1958710	hsa-miR-3182	CLIP-seq
MIRT2498812	hsa-miR-3187-3p	CLIP-seq
MIRT2498813	hsa-miR-323b-3p	CLIP-seq
MIRT2498814	hsa-miR-346	CLIP-seq
MIRT2436159	hsa-miR-3617	CLIP-seq
MIRT2498815	hsa-miR-3622a-3p	CLIP-seq
MIRT2498816	hsa-miR-3622b-3p	CLIP-seq
MIRT2677531	hsa-miR-3665	CLIP-seq
MIRT2498819	hsa-miR-3674	CLIP-seq
MIRT2498820	hsa-miR-3679-3p	CLIP-seq
MIRT1958713	hsa-miR-3686	CLIP-seq
MIRT2498821	hsa-miR-3688-3p	CLIP-seq
MIRT2498822	hsa-miR-3690	CLIP-seq
MIRT2498823	hsa-miR-3714	CLIP-seq
MIRT871705	hsa-miR-371-5p	CLIP-seq
MIRT871706	hsa-miR-371b-5p	CLIP-seq
MIRT2436160	hsa-miR-372	CLIP-seq
MIRT2436161	hsa-miR-373	CLIP-seq
MIRT2498824	hsa-miR-3910	CLIP-seq
MIRT2498825	hsa-miR-3919	CLIP-seq
MIRT2498826	hsa-miR-3925-3p	CLIP-seq
MIRT2498827	hsa-miR-3925-5p	CLIP-seq
MIRT2498828	hsa-miR-3929	CLIP-seq
MIRT2498829	hsa-miR-3973	CLIP-seq
MIRT2498830	hsa-miR-412	CLIP-seq
MIRT2498831	hsa-miR-4254	CLIP-seq
MIRT2498832	hsa-miR-4256	CLIP-seq
MIRT2677532	hsa-miR-4276	CLIP-seq
MIRT2498833	hsa-miR-4287	CLIP-seq
MIRT2498834	hsa-miR-4297	CLIP-seq
MIRT2677533	hsa-miR-4302	CLIP-seq
MIRT2498835	hsa-miR-4312	CLIP-seq
MIRT2498836	hsa-miR-4316	CLIP-seq
MIRT2498837	hsa-miR-4317	CLIP-seq
MIRT2498838	hsa-miR-4324	CLIP-seq
MIRT2677534	hsa-miR-4327	CLIP-seq
MIRT2498839	hsa-miR-4330	CLIP-seq
MIRT2498840	hsa-miR-4419b	CLIP-seq
MIRT2498841	hsa-miR-4422	CLIP-seq
MIRT2498842	hsa-miR-4435	CLIP-seq
MIRT2498843	hsa-miR-4437	CLIP-seq
MIRT2498844	hsa-miR-4450	CLIP-seq
MIRT2498845	hsa-miR-4458	CLIP-seq
MIRT2498846	hsa-miR-4478	CLIP-seq
MIRT2498847	hsa-miR-4482	CLIP-seq
MIRT2498848	hsa-miR-449c	CLIP-seq
MIRT2498849	hsa-miR-4500	CLIP-seq
MIRT2498851	hsa-miR-4530	CLIP-seq
MIRT2436162	hsa-miR-454	CLIP-seq
MIRT2498852	hsa-miR-4635	CLIP-seq
MIRT2498853	hsa-miR-4642	CLIP-seq
MIRT871713	hsa-miR-4649-3p	CLIP-seq
MIRT2498854	hsa-miR-4659a-5p	CLIP-seq
MIRT2498855	hsa-miR-4659b-5p	CLIP-seq
MIRT2498856	hsa-miR-4660	CLIP-seq
MIRT871715	hsa-miR-4661-3p	CLIP-seq
MIRT2498857	hsa-miR-4662a-5p	CLIP-seq
MIRT2498858	hsa-miR-4667-5p	CLIP-seq
MIRT2498859	hsa-miR-4674	CLIP-seq
MIRT2436163	hsa-miR-4677-3p	CLIP-seq
MIRT2498860	hsa-miR-4678	CLIP-seq
MIRT2498861	hsa-miR-4685-3p	CLIP-seq
MIRT2498862	hsa-miR-4698	CLIP-seq
MIRT2498863	hsa-miR-4700-5p	CLIP-seq
MIRT2498864	hsa-miR-4701-5p	CLIP-seq
MIRT2677535	hsa-miR-4703-3p	CLIP-seq
MIRT2498865	hsa-miR-4715-5p	CLIP-seq
MIRT2677536	hsa-miR-4722-3p	CLIP-seq
MIRT2498866	hsa-miR-4724-5p	CLIP-seq
MIRT871716	hsa-miR-4728-5p	CLIP-seq
MIRT2498867	hsa-miR-4731-5p	CLIP-seq
MIRT2498868	hsa-miR-4732-5p	CLIP-seq
MIRT2498869	hsa-miR-4738-3p	CLIP-seq
MIRT871717	hsa-miR-4739	CLIP-seq
MIRT1958721	hsa-miR-4742-3p	CLIP-seq
MIRT2498870	hsa-miR-4745-3p	CLIP-seq
MIRT2498871	hsa-miR-4753-5p	CLIP-seq
MIRT2436165	hsa-miR-4756-3p	CLIP-seq
MIRT871718	hsa-miR-4756-5p	CLIP-seq
MIRT2498872	hsa-miR-4773	CLIP-seq
MIRT2498873	hsa-miR-4776-3p	CLIP-seq
MIRT2498874	hsa-miR-4778-3p	CLIP-seq
MIRT871720	hsa-miR-4780	CLIP-seq
MIRT871721	hsa-miR-4784	CLIP-seq
MIRT2498875	hsa-miR-4786-5p	CLIP-seq
MIRT2436166	hsa-miR-4802-3p	CLIP-seq
MIRT2498876	hsa-miR-4803	CLIP-seq
MIRT2498877	hsa-miR-500a	CLIP-seq
MIRT2498878	hsa-miR-501-5p	CLIP-seq
MIRT2498879	hsa-miR-5047	CLIP-seq
MIRT2498880	hsa-miR-506	CLIP-seq
MIRT2498881	hsa-miR-5096	CLIP-seq
MIRT871724	hsa-miR-513c	CLIP-seq
MIRT871725	hsa-miR-514b-5p	CLIP-seq
MIRT2436167	hsa-miR-519a	CLIP-seq
MIRT2498882	hsa-miR-544b	CLIP-seq
MIRT2498883	hsa-miR-548ac	CLIP-seq
MIRT2498884	hsa-miR-548ae	CLIP-seq
MIRT2498885	hsa-miR-548aj	CLIP-seq
MIRT2498886	hsa-miR-548am	CLIP-seq
MIRT2498889	hsa-miR-548d-3p	CLIP-seq
MIRT2498890	hsa-miR-548g	CLIP-seq
MIRT2498891	hsa-miR-548o	CLIP-seq
MIRT2498892	hsa-miR-548p	CLIP-seq
MIRT2498893	hsa-miR-548s	CLIP-seq
MIRT871726	hsa-miR-548v	CLIP-seq
MIRT2498894	hsa-miR-548x	CLIP-seq
MIRT2498895	hsa-miR-548z	CLIP-seq
MIRT2498896	hsa-miR-570	CLIP-seq
MIRT2498897	hsa-miR-571	CLIP-seq
MIRT2498898	hsa-miR-577	CLIP-seq
MIRT2498899	hsa-miR-583	CLIP-seq
MIRT2498900	hsa-miR-588	CLIP-seq
MIRT2498901	hsa-miR-615-5p	CLIP-seq
MIRT871728	hsa-miR-623	CLIP-seq
MIRT871729	hsa-miR-628-5p	CLIP-seq
MIRT1958725	hsa-miR-630	CLIP-seq
MIRT2436170	hsa-miR-641	CLIP-seq
MIRT2677537	hsa-miR-657	CLIP-seq
MIRT871730	hsa-miR-659	CLIP-seq
MIRT2498902	hsa-miR-7	CLIP-seq
MIRT2677538	hsa-miR-708	CLIP-seq
MIRT2498903	hsa-miR-766	CLIP-seq
MIRT2677539	hsa-miR-767-5p	CLIP-seq
MIRT2498904	hsa-miR-769-5p	CLIP-seq
MIRT2498905	hsa-miR-875-3p	CLIP-seq
MIRT2498906	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ABL1	Activation	15509806
BCL6	Repression	15509806;22723377
EGR1	Unknown	20590664
ETV4	Activation	9339900
FOXL2	Repression	21862621
FOXO3	Repression	15509806
GATA4	Activation	24416423
HDAC1	Repression	11511535
IRF9	Repression	15362048
MAF	Unknown	15755896
MAFB	Unknown	15755896
MYC	Activation	9339900
MYC	Unknown	21790895
NFKB1	Activation	21790895
NFKB2	Activation	18504428
NFYA	Activation	9339900
NFYB	Activation	9339900
NFYC	Activation	9339900
RELA	Activation	18504428;21790895
RUNX1	Unknown	19379567
SMAD3	Activation	24416423
SP1	Activation	9339900
SP1	Unknown	11160217
STAT3	Unknown	12147685
STAT5A	Repression	22723377
TRRAP	Activation	11511535

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739, 19237565
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	18827403
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	7603984
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	33854239
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	8114739, 18827403
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0000785	Component	Chromatin	IDA	18827403
GO:0005515	Function	Protein binding	IPI	9840943, 11896535, 16189514, 16765349, 23455922, 23602568, 25241761, 25416956, 25910212, 26871637, 27107012, 28514442, 31515488, 32296183, 32707033, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18827403
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	18827403
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	IDA	18827403
GO:0005829	Component	Cytosol	TAS
GO:0007616	Process	Long-term memory	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	24130168
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0019901	Function	Protein kinase binding	IPI	8114739
GO:0031965	Component	Nuclear membrane	IDA	18827403
GO:0031965	Component	Nuclear membrane	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	24130168
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	8114739
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	18827403
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	33854239
GO:0071481	Process	Cellular response to X-ray	IEA
GO:0097129	Component	Cyclin D2-CDK4 complex	IEA
GO:0097129	Component	Cyclin D2-CDK4 complex	IPI	11896535
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IBA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	24130168
GO:1901992	Process	Positive regulation of mitotic cell cycle phase transition	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IEA

Other IDs

• MIM: 123833
• HGNC: 1583
• e!Ensembl: ENSG00000118971

Protein

• UniProt ID: P30279
• Protein name: G1/S-specific cyclin-D2
• Protein function: Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition (PubMed:18827403, PubMed:8114739). Pho
• PDB: 6EI2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	25 → 152	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	154 → 282	Cyclin, C-terminal domain	Domain

• Sequence:

  MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
  TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTA
  EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKH
  AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDV
  DCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

• Sequence length: 289

Pathways

KEGG:

FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Focal adhesion
JAK-STAT signaling pathway
Prolactin signaling pathway
Measles
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer

Reactome:

Cyclin D associated events in G1
Regulation of RUNX1 Expression and Activity

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 1	Likely pathogenic; Pathogenic	rs777786993	RCV003493877	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3	Pathogenic; Likely pathogenic	rs587777618, rs587777619, rs587777620, rs587777621, rs587777622, rs776036883, rs1864225645	RCV000133495 RCV000133496 RCV000133497 RCV000133498 RCV000133500 RCV003232905 RCV004594733 RCV000824980 RCV005012703	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Seizure	Likely pathogenic; Pathogenic	rs587777620	RCV001849314	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCND2-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROCEPHALUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERISYLVIAN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYDACTYLY, POSTAXIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYDACTYLY, POSTAXIAL, TYPE A1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMICROGYRIA, BILATERAL PERISYLVIAN, AUTOSOMAL RECESSIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11691826		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	27798625		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	27798625		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12684418, 26466823, 31527584		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	23266556, 29917119, 30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	12684418		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25078331	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11691826		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	17593082		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	26290144		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10416984		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27145278		★☆☆☆☆ Found in Text Mining only
Aqueductal Stenosis	Aqueductal Stenosis	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21676922	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20077038, 28493234		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21059263	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26261659	Stimulate	★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	30334451		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21504716, 25207815, 30127911		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	7742549		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	18995218	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19564623	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30778022, 30925453		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	11691826		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	23199169	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20077038, 28493234		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34864569	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	12375011		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11289162, 12375011, 14506731, 15508191, 15671542, 17855699, 24586797, 25408372, 25684485, 25824739, 27245195, 28218039, 28755423, 29282690, 29945347, 30308939, 31084542, 8336939		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	15508191		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11839581, 12878861, 17611401, 18381931, 18485221, 19706770, 21383541, 22048254, 22986510, 25408372, 25824739, 25927147, 28218039, 28222775, 28755423, 29197760, 29562954, 29945347, 30308939, 36673982	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	7529333, 8045261, 8959341		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	7529333, 8045261	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12771922, 16012517	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11343741, 12771922, 17016690, 9738978		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35505292	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19140237, 33320844, 37204480, 38062093	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28258914	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18769130	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30778022, 30925453		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17270028, 30864742, 30952937	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18995218, 30836094	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24980822, 27583477, 32712616, 33932757	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27164935	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17270028, 18281541, 30205383		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	31705051	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31705051		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	37222325	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11691826, 24743557		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	26290144		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22446083	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Choriocarcinoma	Choriocarcinoma	BEFREE	16424014		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10460609, 15289859, 15902296, 7742549		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26705104	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	16306446		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24118792	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31612065		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	16012517	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21039844, 24968322, 28933597, 31511084, 31729531		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASDB_DG	23266556		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	23266556, 29917119, 30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16012517, 24968322, 27080994, 31511084, 31729531, 32170005, 35617032, 35786622	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	21153447, 23266556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	23266556, 29917119, 30510241, 31089142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Communicating Hydrocephalus	Communicating Hydrocephalus	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	31056854		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11552984, 9530346		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29359783		★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	37501076	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31958024	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31315286	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19252133, 25605810	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24464100, 25605810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	24464100		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29358691, 30054458, 30595370, 31118516		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	37222325	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17593082, 19706817, 20016842, 21479697, 26985765, 27825111, 30755239		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	15627943, 16766701, 17486076, 19641124, 22228622, 22500628, 22729222, 22729223, 22729224, 23624932, 24705253, 26520804, 28941273		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33690729	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17270028		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	26393798, 28404587		★☆☆☆☆ Found in Text Mining only
Fetal Cerebral Ventriculomegaly	Fetal Cerebral Ventriculomegaly	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	30097674		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28919164		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	15713710		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15713710		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	20062012	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	11358847		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26482474, 31034050, 31568682		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26782072, 31034050, 31568682	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26482474, 31034050, 31568682		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10416984, 30520141, 30973678		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10416984, 25572712	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	33320844	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	15574200		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21878903		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	8547659	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	10482983		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	34096637	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33320844	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	31059558		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18647968	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	15354186, 18507033, 20062012	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	9530346		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	CTD_human_DG	29642246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydrocephalus	Hydrocephalus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydrocephalus Ex-Vacuo	Hydrocephalus Ex-Vacuo	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28941273		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29662889		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30300583		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30301879		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	33200654	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	12684418		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	17383681		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	28643014		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19464003	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17873913		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24743557, 39519258, 39950487	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20062012, 25924238, 27798625, 27843138, 30381403, 38002257	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20062012, 27843138		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	27798625		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	11992406		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	28643014		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24947332		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20064498, 21128228, 22192146, 31059558		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	34096637	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20849603		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20849603, 28662101, 30308939	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19140237, 36694220	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11291051, 20062012		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18391076		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20062012	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	7742549	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10460609		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10460609		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16614728		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10416984		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	18391076		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	18685613, 19608671, 19880778, 20062012, 21504716, 21745168, 23255553		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11251971, 17636483		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11289162, 12375011, 14506731, 15508191, 15671542, 17855699, 24586797, 25408372, 25684485, 25824739, 27245195, 28218039, 28755423, 29282690, 29945347, 30308939, 31084542, 8336939		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27583477		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	23266556, 29917119, 30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14506731		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24947332		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	17270028		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18281541, 30205383		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12684418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14581343, 17016690, 19577536, 20067451, 20418948, 23349020, 23428540, 25980436, 27576364, 28674394, 29471894		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17016690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12771922, 19337254, 24130168, 25960238, 30950241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20372070, 28670492		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30778022, 30925453		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10482983, 14581343, 14614048, 16270038, 20372070, 23349020, 24743557, 27045317, 28344988, 30950241, 31597162, 7742549, 8945475, 9530346		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	23266556, 29917119, 30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31612065		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14506731, 18837953		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14601057		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16123218, 18391076, 18685613, 19608671, 19783727, 19880778, 20062012, 21504716, 21745168, 23255553, 23429984, 26261659, 26985765		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21059263, 26290144	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	26290144		★☆☆☆☆ Found in Text Mining only
Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	ORPHANET_DG	24705253		★☆☆☆☆ Found in Text Mining only
Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	CTD_human_DG	24705253, 29642246		★☆☆☆☆ Found in Text Mining only
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 1	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	GENOMICS_ENGLAND_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 3	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	GENOMICS_ENGLAND_DG	24705253		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 3	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	UNIPROT_DG	24705253		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 3	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	CLINVAR_DG	24705253		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Megalencephaly-polymicrogyria-postaxial polydactyly-hydrocephalus syndrome	Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11253137	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	20077038, 28493234		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19218339	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29764627		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	35437818, 37501076	Associate	★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33545567	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	CLINVAR_DG	15627943, 16766701, 17486076, 19641124, 22228622, 22500628, 22729222, 22729223, 22729224, 23624932, 24705253, 26520804, 28941273		★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	15627943, 16766701, 17486076, 19641124, 22228622, 22500628, 22729222, 22729223, 22729224, 23624932, 24705253, 26520804, 28941273		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11552984, 15755896, 20709908, 21057542, 23424776, 27146121, 33138842, 34521827, 9565604	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14998494, 15289859, 16129847, 19548309, 21057542, 26341922, 26907633, 28584253		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11691826		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29018036, 31629738		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic dystonia	Myoclonic dystonia	Pubtator	18391076	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37898408	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	10929762, 34255617, 36515758	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26707908		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	10929762	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10634406, 11358847, 12375011, 12684418, 14581343, 14612939, 15316056, 15508191, 15671542, 16224153, 16872438, 17016690, 17043650, 17270028, 17489986, 18431519, 18485221, 19118010, 19618401, 20016842, 20062012, 20077038, 20414251, 20418948, 21153447, 21242119, 21383541, 22192146, 23349020, 25495168, 25824739, 27371349, 28162277, 28222775, 28404587, 29282690, 29367756, 30950241, 31059558, 31527584, 31597162, 31664194, 8481900, 9738978		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20830616, 26510683, 9935245		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14506731, 22534667, 27494902, 30227870, 30664171, 30722989, 30950241, 31253987		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	11343741, 23104224		★☆☆☆☆ Found in Text Mining only
Obstructive Hydrocephalus	Obstructive Hydrocephalus	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23129384, 24025361	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	17270028		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18281541, 30205383		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17270028, 18281541, 30205383, 30864742, 31709901	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12684418, 30021382		★☆☆☆☆ Found in Text Mining only
Perisylvian syndrome	Perisylvian Syndrome	CTD_human_DG	29642246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	25495168, 25646509, 30247605		★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	GENOMICS_ENGLAND_DG	24705253		★☆☆☆☆ Found in Text Mining only
POLYDACTYLY, POSTAXIAL	Polydactyly	CTD_human_DG	29642246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polydactyly, Postaxial, Type A1	Polydactyly	CTD_human_DG	29642246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymicrogyria	Polymicrogyria	Pubtator	33818783	Associate	★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Postaxial polydactyly type A	Polydactyly	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
POSTAXIAL POLYDACTYLY, TYPE B	Postaxial polydactyly	CTD_human_DG	29642246		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16270038, 24743557		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14581343, 17016690, 19577536, 20067451, 20418948, 23349020, 23428540, 25980436, 27576364, 28674394, 29471894		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	14581343, 28674394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14581343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17016690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20418948, 20565761, 21694441, 23591848, 24769028, 24797896, 25193387, 27576364, 27708246, 28674394, 32784653, 33522043, 38087324, 39574470	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27583477		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15172750, 30990963		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	35867756	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	11719506, 22330340		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	22330340	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28643014		★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	23178314	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17849003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17849003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19564623	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25738424	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	9056671		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	11291051, 28344988		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	14506731		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	12375011		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12112307		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12112307		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24425785, 26986233, 33545567	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	14612939, 24130168, 25960238, 30950241		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12771922		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12771922, 19337254, 33993193, 35266852, 37823387	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16424013		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	14670177		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	14670177, 17167184	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	32885893	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20372070, 21752897, 28670492		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18661512, 20372070, 28670492		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18661512, 36694220	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	18661512	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25684485		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38111587	Associate	★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	10634406		★☆☆☆☆ Found in Text Mining only
Ulnar polydactyly of fingers	Postaxial hand polydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18843024, 24577895	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30097674		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22848417	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★☆☆☆☆ Found in Text Mining only