Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8935
Gene name	Src kinase associated phosphoprotein 2
Gene symbol	SKAP2
Synonyms (NCBI Gene)	PRAPRA70SAPSSCAP2SKAP-HOMSKAP55R
Chromosome	7
Chromosome location	7p15.2
Summary	The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating prop

434

Show/Hide all (434)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003875	hsa-miR-15a-5p	MicroarrayqRT-PCR	18362358
MIRT004369	hsa-miR-16-5p	MicroarrayqRT-PCR	18362358
MIRT017252	hsa-miR-335-5p	Microarray	18185580
MIRT042017	hsa-miR-484	CLASH	23622248
MIRT666349	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT666348	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT666347	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT666346	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT666345	hsa-miR-4251	HITS-CLIP	23824327
MIRT666344	hsa-miR-4329	HITS-CLIP	23824327
MIRT666342	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT666343	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT666341	hsa-miR-4770	HITS-CLIP	23824327
MIRT666340	hsa-miR-6088	HITS-CLIP	23824327
MIRT666339	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT666338	hsa-miR-1273f	HITS-CLIP	23824327
MIRT666337	hsa-miR-4534	HITS-CLIP	23824327
MIRT666336	hsa-miR-8082	HITS-CLIP	23824327
MIRT666335	hsa-miR-1289	HITS-CLIP	23824327
MIRT666334	hsa-miR-4294	HITS-CLIP	23824327
MIRT666333	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT666332	hsa-miR-4303	HITS-CLIP	23824327
MIRT666331	hsa-miR-3198	HITS-CLIP	23824327
MIRT666330	hsa-miR-4309	HITS-CLIP	23824327
MIRT666329	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT633646	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT633645	hsa-miR-3200-3p	HITS-CLIP	23824327
MIRT633644	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT633643	hsa-miR-24-1-5p	HITS-CLIP	23824327
MIRT633642	hsa-miR-24-2-5p	HITS-CLIP	23824327
MIRT633641	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT633640	hsa-miR-498	HITS-CLIP	23824327
MIRT666332	hsa-miR-4303	HITS-CLIP	27418678
MIRT666329	hsa-miR-4762-3p	HITS-CLIP	27418678
MIRT666349	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT666348	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT666347	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT666346	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT666345	hsa-miR-4251	HITS-CLIP	23824327
MIRT666344	hsa-miR-4329	HITS-CLIP	23824327
MIRT666342	hsa-miR-6761-5p	HITS-CLIP	23824327
MIRT666343	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT666341	hsa-miR-4770	HITS-CLIP	23824327
MIRT666340	hsa-miR-6088	HITS-CLIP	23824327
MIRT666339	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT666338	hsa-miR-1273f	HITS-CLIP	23824327
MIRT666337	hsa-miR-4534	HITS-CLIP	23824327
MIRT666336	hsa-miR-8082	HITS-CLIP	23824327
MIRT666335	hsa-miR-1289	HITS-CLIP	23824327
MIRT666334	hsa-miR-4294	HITS-CLIP	23824327
MIRT666333	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT666332	hsa-miR-4303	HITS-CLIP	23824327
MIRT666331	hsa-miR-3198	HITS-CLIP	23824327
MIRT666330	hsa-miR-4309	HITS-CLIP	23824327
MIRT666329	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT633646	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT633645	hsa-miR-3200-3p	HITS-CLIP	23824327
MIRT633644	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT633643	hsa-miR-24-1-5p	HITS-CLIP	23824327
MIRT633642	hsa-miR-24-2-5p	HITS-CLIP	23824327
MIRT633641	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT633640	hsa-miR-498	HITS-CLIP	23824327
MIRT1350906	hsa-miR-122	CLIP-seq
MIRT1350907	hsa-miR-1228	CLIP-seq
MIRT1350908	hsa-miR-1297	CLIP-seq
MIRT1350909	hsa-miR-140-5p	CLIP-seq
MIRT1350910	hsa-miR-143	CLIP-seq
MIRT1350911	hsa-miR-186	CLIP-seq
MIRT1350912	hsa-miR-197	CLIP-seq
MIRT1350913	hsa-miR-26a	CLIP-seq
MIRT1350914	hsa-miR-26b	CLIP-seq
MIRT1350915	hsa-miR-3064-5p	CLIP-seq
MIRT1350916	hsa-miR-3133	CLIP-seq
MIRT1350917	hsa-miR-3135b	CLIP-seq
MIRT1350918	hsa-miR-3144-3p	CLIP-seq
MIRT1350919	hsa-miR-3146	CLIP-seq
MIRT1350920	hsa-miR-3163	CLIP-seq
MIRT1350921	hsa-miR-3192	CLIP-seq
MIRT1350922	hsa-miR-3545-5p	CLIP-seq
MIRT1350923	hsa-miR-3647-3p	CLIP-seq
MIRT1350924	hsa-miR-3652	CLIP-seq
MIRT1350925	hsa-miR-3689a-5p	CLIP-seq
MIRT1350926	hsa-miR-3689b	CLIP-seq
MIRT1350927	hsa-miR-3689e	CLIP-seq
MIRT1350928	hsa-miR-3689f	CLIP-seq
MIRT1350929	hsa-miR-3908	CLIP-seq
MIRT1350930	hsa-miR-3942-5p	CLIP-seq
MIRT1350931	hsa-miR-411	CLIP-seq
MIRT1350932	hsa-miR-4272	CLIP-seq
MIRT1350933	hsa-miR-4430	CLIP-seq
MIRT1350934	hsa-miR-4460	CLIP-seq
MIRT1350935	hsa-miR-4465	CLIP-seq
MIRT1350936	hsa-miR-4501	CLIP-seq
MIRT1350937	hsa-miR-4505	CLIP-seq
MIRT1350938	hsa-miR-4536	CLIP-seq
MIRT1350939	hsa-miR-4703-5p	CLIP-seq
MIRT1350940	hsa-miR-4716-5p	CLIP-seq
MIRT1350941	hsa-miR-4727-3p	CLIP-seq
MIRT1350942	hsa-miR-4766-3p	CLIP-seq
MIRT1350943	hsa-miR-4781-3p	CLIP-seq
MIRT1350944	hsa-miR-4803	CLIP-seq
MIRT1350945	hsa-miR-5096	CLIP-seq
MIRT1350946	hsa-miR-562	CLIP-seq
MIRT2103947	hsa-miR-1208	CLIP-seq
MIRT2103948	hsa-miR-1224-3p	CLIP-seq
MIRT2103949	hsa-miR-1260	CLIP-seq
MIRT2103950	hsa-miR-1260b	CLIP-seq
MIRT2103951	hsa-miR-1264	CLIP-seq
MIRT2103952	hsa-miR-1270	CLIP-seq
MIRT2103953	hsa-miR-1280	CLIP-seq
MIRT1350910	hsa-miR-143	CLIP-seq
MIRT2103954	hsa-miR-145	CLIP-seq
MIRT2103955	hsa-miR-149	CLIP-seq
MIRT2103956	hsa-miR-150	CLIP-seq
MIRT2103957	hsa-miR-183	CLIP-seq
MIRT2103958	hsa-miR-2964a-5p	CLIP-seq
MIRT1350915	hsa-miR-3064-5p	CLIP-seq
MIRT2103959	hsa-miR-3124-3p	CLIP-seq
MIRT2103960	hsa-miR-3126-3p	CLIP-seq
MIRT2103961	hsa-miR-3160-5p	CLIP-seq
MIRT2103962	hsa-miR-3591-3p	CLIP-seq
MIRT2103963	hsa-miR-3614-5p	CLIP-seq
MIRT2103964	hsa-miR-3686	CLIP-seq
MIRT1350929	hsa-miR-3908	CLIP-seq
MIRT2103965	hsa-miR-4328	CLIP-seq
MIRT2103966	hsa-miR-433	CLIP-seq
MIRT2103967	hsa-miR-4511	CLIP-seq
MIRT2103968	hsa-miR-4539	CLIP-seq
MIRT2103969	hsa-miR-4636	CLIP-seq
MIRT2103970	hsa-miR-4683	CLIP-seq
MIRT2103971	hsa-miR-4713-5p	CLIP-seq
MIRT2103972	hsa-miR-4718	CLIP-seq
MIRT2103973	hsa-miR-4719	CLIP-seq
MIRT2103974	hsa-miR-4735-5p	CLIP-seq
MIRT2103975	hsa-miR-4742-3p	CLIP-seq
MIRT1350942	hsa-miR-4766-3p	CLIP-seq
MIRT2103976	hsa-miR-4775	CLIP-seq
MIRT2103977	hsa-miR-4794	CLIP-seq
MIRT2103978	hsa-miR-4799-5p	CLIP-seq
MIRT2103979	hsa-miR-532-3p	CLIP-seq
MIRT2103980	hsa-miR-548aa	CLIP-seq
MIRT2103981	hsa-miR-548ag	CLIP-seq
MIRT2103982	hsa-miR-548ai	CLIP-seq
MIRT2103983	hsa-miR-548b-3p	CLIP-seq
MIRT2103984	hsa-miR-548m	CLIP-seq
MIRT1350946	hsa-miR-562	CLIP-seq
MIRT2103985	hsa-miR-570	CLIP-seq
MIRT2103986	hsa-miR-578	CLIP-seq
MIRT2103987	hsa-miR-590-3p	CLIP-seq
MIRT2103988	hsa-miR-605	CLIP-seq
MIRT2103989	hsa-miR-620	CLIP-seq
MIRT2103990	hsa-miR-622	CLIP-seq
MIRT2103991	hsa-miR-633	CLIP-seq
MIRT2103992	hsa-miR-654-3p	CLIP-seq
MIRT2103993	hsa-miR-668	CLIP-seq
MIRT2103994	hsa-miR-891b	CLIP-seq
MIRT2328141	hsa-miR-1205	CLIP-seq
MIRT1350906	hsa-miR-122	CLIP-seq
MIRT2328142	hsa-miR-1305	CLIP-seq
MIRT2328143	hsa-miR-140-3p	CLIP-seq
MIRT1350910	hsa-miR-143	CLIP-seq
MIRT1350915	hsa-miR-3064-5p	CLIP-seq
MIRT1350917	hsa-miR-3135b	CLIP-seq
MIRT2328144	hsa-miR-3167	CLIP-seq
MIRT2328145	hsa-miR-330-3p	CLIP-seq
MIRT2328146	hsa-miR-3613-3p	CLIP-seq
MIRT1350924	hsa-miR-3652	CLIP-seq
MIRT2328147	hsa-miR-4291	CLIP-seq
MIRT2328148	hsa-miR-4310	CLIP-seq
MIRT1350933	hsa-miR-4430	CLIP-seq
MIRT2328149	hsa-miR-450b-5p	CLIP-seq
MIRT2103967	hsa-miR-4511	CLIP-seq
MIRT2328150	hsa-miR-4634	CLIP-seq
MIRT2103973	hsa-miR-4719	CLIP-seq
MIRT2328151	hsa-miR-4766-5p	CLIP-seq
MIRT2328152	hsa-miR-4769-3p	CLIP-seq
MIRT2103981	hsa-miR-548ag	CLIP-seq
MIRT2103982	hsa-miR-548ai	CLIP-seq
MIRT2103983	hsa-miR-548b-3p	CLIP-seq
MIRT2103984	hsa-miR-548m	CLIP-seq
MIRT2103985	hsa-miR-570	CLIP-seq
MIRT2328153	hsa-miR-876-5p	CLIP-seq
MIRT2103994	hsa-miR-891b	CLIP-seq
MIRT1350906	hsa-miR-122	CLIP-seq
MIRT1350917	hsa-miR-3135b	CLIP-seq
MIRT1350924	hsa-miR-3652	CLIP-seq
MIRT1350933	hsa-miR-4430	CLIP-seq
MIRT2328150	hsa-miR-4634	CLIP-seq
MIRT2622971	hsa-miR-1179	CLIP-seq
MIRT1350906	hsa-miR-122	CLIP-seq
MIRT2103948	hsa-miR-1224-3p	CLIP-seq
MIRT2622972	hsa-miR-1253	CLIP-seq
MIRT2622973	hsa-miR-1255a	CLIP-seq
MIRT2622974	hsa-miR-1255b	CLIP-seq
MIRT2103949	hsa-miR-1260	CLIP-seq
MIRT2103950	hsa-miR-1260b	CLIP-seq
MIRT2622975	hsa-miR-1263	CLIP-seq
MIRT2103951	hsa-miR-1264	CLIP-seq
MIRT2103952	hsa-miR-1270	CLIP-seq
MIRT2103953	hsa-miR-1280	CLIP-seq
MIRT1350908	hsa-miR-1297	CLIP-seq
MIRT2622976	hsa-miR-141	CLIP-seq
MIRT2622977	hsa-miR-142-5p	CLIP-seq
MIRT2103954	hsa-miR-145	CLIP-seq
MIRT2622978	hsa-miR-148a	CLIP-seq
MIRT2622979	hsa-miR-148b	CLIP-seq
MIRT2103956	hsa-miR-150	CLIP-seq
MIRT2622980	hsa-miR-152	CLIP-seq
MIRT1350911	hsa-miR-186	CLIP-seq
MIRT2622981	hsa-miR-200a	CLIP-seq
MIRT2622982	hsa-miR-221	CLIP-seq
MIRT2622983	hsa-miR-222	CLIP-seq
MIRT2622984	hsa-miR-2276	CLIP-seq
MIRT2622985	hsa-miR-23a	CLIP-seq
MIRT2622986	hsa-miR-23b	CLIP-seq
MIRT2622987	hsa-miR-23c	CLIP-seq
MIRT2622988	hsa-miR-24	CLIP-seq
MIRT1350913	hsa-miR-26a	CLIP-seq
MIRT1350914	hsa-miR-26b	CLIP-seq
MIRT2622989	hsa-miR-27a	CLIP-seq
MIRT2622990	hsa-miR-27b	CLIP-seq
MIRT2622991	hsa-miR-298	CLIP-seq
MIRT2103959	hsa-miR-3124-3p	CLIP-seq
MIRT1350916	hsa-miR-3133	CLIP-seq
MIRT1350917	hsa-miR-3135b	CLIP-seq
MIRT2622992	hsa-miR-3145-3p	CLIP-seq
MIRT2622993	hsa-miR-3149	CLIP-seq
MIRT2103961	hsa-miR-3160-5p	CLIP-seq
MIRT2622994	hsa-miR-3166	CLIP-seq
MIRT2328144	hsa-miR-3167	CLIP-seq
MIRT2622995	hsa-miR-3180-5p	CLIP-seq
MIRT2622996	hsa-miR-3194-3p	CLIP-seq
MIRT2328145	hsa-miR-330-3p	CLIP-seq
MIRT2622997	hsa-miR-331-5p	CLIP-seq
MIRT2622998	hsa-miR-340	CLIP-seq
MIRT2103962	hsa-miR-3591-3p	CLIP-seq
MIRT2622999	hsa-miR-3622a-3p	CLIP-seq
MIRT2623000	hsa-miR-3622b-3p	CLIP-seq
MIRT1350923	hsa-miR-3647-3p	CLIP-seq
MIRT1350924	hsa-miR-3652	CLIP-seq
MIRT2623001	hsa-miR-3667-3p	CLIP-seq
MIRT2623002	hsa-miR-3678-3p	CLIP-seq
MIRT2623003	hsa-miR-3680	CLIP-seq
MIRT2103964	hsa-miR-3686	CLIP-seq
MIRT1350925	hsa-miR-3689a-5p	CLIP-seq
MIRT1350926	hsa-miR-3689b	CLIP-seq
MIRT1350927	hsa-miR-3689e	CLIP-seq
MIRT1350928	hsa-miR-3689f	CLIP-seq
MIRT1350929	hsa-miR-3908	CLIP-seq
MIRT2623004	hsa-miR-3915	CLIP-seq
MIRT2623005	hsa-miR-3921	CLIP-seq
MIRT2623006	hsa-miR-3925-3p	CLIP-seq
MIRT2623007	hsa-miR-3928	CLIP-seq
MIRT1350930	hsa-miR-3942-5p	CLIP-seq
MIRT2623008	hsa-miR-4263	CLIP-seq
MIRT1350932	hsa-miR-4272	CLIP-seq
MIRT2623009	hsa-miR-4276	CLIP-seq
MIRT2623010	hsa-miR-4279	CLIP-seq
MIRT2623011	hsa-miR-4284	CLIP-seq
MIRT2623012	hsa-miR-4287	CLIP-seq
MIRT2623013	hsa-miR-4292	CLIP-seq
MIRT2623014	hsa-miR-4308	CLIP-seq
MIRT2623015	hsa-miR-4312	CLIP-seq
MIRT2103965	hsa-miR-4328	CLIP-seq
MIRT2103966	hsa-miR-433	CLIP-seq
MIRT2623016	hsa-miR-4422	CLIP-seq
MIRT1350933	hsa-miR-4430	CLIP-seq
MIRT1350935	hsa-miR-4465	CLIP-seq
MIRT2623017	hsa-miR-4469	CLIP-seq
MIRT1350936	hsa-miR-4501	CLIP-seq
MIRT2328149	hsa-miR-450b-5p	CLIP-seq
MIRT2103967	hsa-miR-4511	CLIP-seq
MIRT2103968	hsa-miR-4539	CLIP-seq
MIRT2328150	hsa-miR-4634	CLIP-seq
MIRT2623018	hsa-miR-4635	CLIP-seq
MIRT2103969	hsa-miR-4636	CLIP-seq
MIRT2623019	hsa-miR-4653-5p	CLIP-seq
MIRT2623020	hsa-miR-4668-3p	CLIP-seq
MIRT2623021	hsa-miR-4678	CLIP-seq
MIRT2103970	hsa-miR-4683	CLIP-seq
MIRT2623022	hsa-miR-4685-3p	CLIP-seq
MIRT2623023	hsa-miR-4686	CLIP-seq
MIRT1350939	hsa-miR-4703-5p	CLIP-seq
MIRT2623024	hsa-miR-4705	CLIP-seq
MIRT2623025	hsa-miR-4709-3p	CLIP-seq
MIRT2103971	hsa-miR-4713-5p	CLIP-seq
MIRT1350940	hsa-miR-4716-5p	CLIP-seq
MIRT2103972	hsa-miR-4718	CLIP-seq
MIRT2103973	hsa-miR-4719	CLIP-seq
MIRT2103975	hsa-miR-4742-3p	CLIP-seq
MIRT2623026	hsa-miR-4757-5p	CLIP-seq
MIRT2623027	hsa-miR-4762-5p	CLIP-seq
MIRT1350942	hsa-miR-4766-3p	CLIP-seq
MIRT2328151	hsa-miR-4766-5p	CLIP-seq
MIRT2328152	hsa-miR-4769-3p	CLIP-seq
MIRT2623028	hsa-miR-4771	CLIP-seq
MIRT2623029	hsa-miR-4772-3p	CLIP-seq
MIRT2623030	hsa-miR-4786-5p	CLIP-seq
MIRT2623031	hsa-miR-4795-3p	CLIP-seq
MIRT2623032	hsa-miR-4798-3p	CLIP-seq
MIRT2103978	hsa-miR-4799-5p	CLIP-seq
MIRT1350944	hsa-miR-4803	CLIP-seq
MIRT2623033	hsa-miR-483-3p	CLIP-seq
MIRT2623034	hsa-miR-508-5p	CLIP-seq
MIRT1350945	hsa-miR-5096	CLIP-seq
MIRT2623035	hsa-miR-513a-3p	CLIP-seq
MIRT2623036	hsa-miR-513a-5p	CLIP-seq
MIRT2103979	hsa-miR-532-3p	CLIP-seq
MIRT2623037	hsa-miR-543	CLIP-seq
MIRT2103981	hsa-miR-548ag	CLIP-seq
MIRT2103982	hsa-miR-548ai	CLIP-seq
MIRT2103983	hsa-miR-548b-3p	CLIP-seq
MIRT2103984	hsa-miR-548m	CLIP-seq
MIRT2623038	hsa-miR-561	CLIP-seq
MIRT2103985	hsa-miR-570	CLIP-seq
MIRT2623039	hsa-miR-576-5p	CLIP-seq
MIRT2103986	hsa-miR-578	CLIP-seq
MIRT2103988	hsa-miR-605	CLIP-seq
MIRT2103989	hsa-miR-620	CLIP-seq
MIRT2103991	hsa-miR-633	CLIP-seq
MIRT2103992	hsa-miR-654-3p	CLIP-seq
MIRT2623040	hsa-miR-656	CLIP-seq
MIRT2623041	hsa-miR-665	CLIP-seq
MIRT2103993	hsa-miR-668	CLIP-seq
MIRT2623042	hsa-miR-769-5p	CLIP-seq
MIRT2328153	hsa-miR-876-5p	CLIP-seq
MIRT2103994	hsa-miR-891b	CLIP-seq
MIRT2103947	hsa-miR-1208	CLIP-seq
MIRT1350906	hsa-miR-122	CLIP-seq
MIRT2103948	hsa-miR-1224-3p	CLIP-seq
MIRT2622972	hsa-miR-1253	CLIP-seq
MIRT2103949	hsa-miR-1260	CLIP-seq
MIRT2103950	hsa-miR-1260b	CLIP-seq
MIRT2622975	hsa-miR-1263	CLIP-seq
MIRT2103951	hsa-miR-1264	CLIP-seq
MIRT2103953	hsa-miR-1280	CLIP-seq
MIRT1350908	hsa-miR-1297	CLIP-seq
MIRT2622976	hsa-miR-141	CLIP-seq
MIRT2622977	hsa-miR-142-5p	CLIP-seq
MIRT2103954	hsa-miR-145	CLIP-seq
MIRT2622978	hsa-miR-148a	CLIP-seq
MIRT2622979	hsa-miR-148b	CLIP-seq
MIRT2103956	hsa-miR-150	CLIP-seq
MIRT2622980	hsa-miR-152	CLIP-seq
MIRT2622981	hsa-miR-200a	CLIP-seq
MIRT2622982	hsa-miR-221	CLIP-seq
MIRT2622983	hsa-miR-222	CLIP-seq
MIRT2622984	hsa-miR-2276	CLIP-seq
MIRT2622988	hsa-miR-24	CLIP-seq
MIRT1350913	hsa-miR-26a	CLIP-seq
MIRT1350914	hsa-miR-26b	CLIP-seq
MIRT2622989	hsa-miR-27a	CLIP-seq
MIRT2622990	hsa-miR-27b	CLIP-seq
MIRT2622991	hsa-miR-298	CLIP-seq
MIRT2103959	hsa-miR-3124-3p	CLIP-seq
MIRT1350916	hsa-miR-3133	CLIP-seq
MIRT1350917	hsa-miR-3135b	CLIP-seq
MIRT2622992	hsa-miR-3145-3p	CLIP-seq
MIRT2103961	hsa-miR-3160-5p	CLIP-seq
MIRT2622994	hsa-miR-3166	CLIP-seq
MIRT2328144	hsa-miR-3167	CLIP-seq
MIRT2622995	hsa-miR-3180-5p	CLIP-seq
MIRT2622996	hsa-miR-3194-3p	CLIP-seq
MIRT2328145	hsa-miR-330-3p	CLIP-seq
MIRT2622998	hsa-miR-340	CLIP-seq
MIRT2622999	hsa-miR-3622a-3p	CLIP-seq
MIRT2623000	hsa-miR-3622b-3p	CLIP-seq
MIRT1350923	hsa-miR-3647-3p	CLIP-seq
MIRT1350924	hsa-miR-3652	CLIP-seq
MIRT2623001	hsa-miR-3667-3p	CLIP-seq
MIRT2623002	hsa-miR-3678-3p	CLIP-seq
MIRT2623003	hsa-miR-3680	CLIP-seq
MIRT2103964	hsa-miR-3686	CLIP-seq
MIRT1350925	hsa-miR-3689a-5p	CLIP-seq
MIRT1350926	hsa-miR-3689b	CLIP-seq
MIRT1350927	hsa-miR-3689e	CLIP-seq
MIRT1350928	hsa-miR-3689f	CLIP-seq
MIRT1350929	hsa-miR-3908	CLIP-seq
MIRT2623005	hsa-miR-3921	CLIP-seq
MIRT2623006	hsa-miR-3925-3p	CLIP-seq
MIRT1350930	hsa-miR-3942-5p	CLIP-seq
MIRT2623008	hsa-miR-4263	CLIP-seq
MIRT1350932	hsa-miR-4272	CLIP-seq
MIRT2623009	hsa-miR-4276	CLIP-seq
MIRT2623010	hsa-miR-4279	CLIP-seq
MIRT2623011	hsa-miR-4284	CLIP-seq
MIRT2623015	hsa-miR-4312	CLIP-seq
MIRT2103965	hsa-miR-4328	CLIP-seq
MIRT2103966	hsa-miR-433	CLIP-seq
MIRT2623016	hsa-miR-4422	CLIP-seq
MIRT1350933	hsa-miR-4430	CLIP-seq
MIRT1350935	hsa-miR-4465	CLIP-seq
MIRT1350936	hsa-miR-4501	CLIP-seq
MIRT2328149	hsa-miR-450b-5p	CLIP-seq
MIRT2328150	hsa-miR-4634	CLIP-seq
MIRT2623018	hsa-miR-4635	CLIP-seq
MIRT2103969	hsa-miR-4636	CLIP-seq
MIRT2623019	hsa-miR-4653-5p	CLIP-seq
MIRT2623020	hsa-miR-4668-3p	CLIP-seq
MIRT1350939	hsa-miR-4703-5p	CLIP-seq
MIRT2623024	hsa-miR-4705	CLIP-seq
MIRT2623025	hsa-miR-4709-3p	CLIP-seq
MIRT2103971	hsa-miR-4713-5p	CLIP-seq
MIRT1350940	hsa-miR-4716-5p	CLIP-seq
MIRT2103972	hsa-miR-4718	CLIP-seq
MIRT2103975	hsa-miR-4742-3p	CLIP-seq
MIRT2623026	hsa-miR-4757-5p	CLIP-seq
MIRT1350942	hsa-miR-4766-3p	CLIP-seq
MIRT2328152	hsa-miR-4769-3p	CLIP-seq
MIRT2623028	hsa-miR-4771	CLIP-seq
MIRT2623029	hsa-miR-4772-3p	CLIP-seq
MIRT2623030	hsa-miR-4786-5p	CLIP-seq
MIRT2623031	hsa-miR-4795-3p	CLIP-seq
MIRT2623032	hsa-miR-4798-3p	CLIP-seq
MIRT2103978	hsa-miR-4799-5p	CLIP-seq
MIRT1350944	hsa-miR-4803	CLIP-seq
MIRT2623033	hsa-miR-483-3p	CLIP-seq
MIRT2623034	hsa-miR-508-5p	CLIP-seq
MIRT2623035	hsa-miR-513a-3p	CLIP-seq
MIRT2623036	hsa-miR-513a-5p	CLIP-seq
MIRT2103979	hsa-miR-532-3p	CLIP-seq
MIRT2623037	hsa-miR-543	CLIP-seq
MIRT2623038	hsa-miR-561	CLIP-seq
MIRT2623039	hsa-miR-576-5p	CLIP-seq
MIRT2103986	hsa-miR-578	CLIP-seq
MIRT2103988	hsa-miR-605	CLIP-seq
MIRT2103991	hsa-miR-633	CLIP-seq
MIRT2103992	hsa-miR-654-3p	CLIP-seq
MIRT2623040	hsa-miR-656	CLIP-seq
MIRT2623041	hsa-miR-665	CLIP-seq
MIRT2103993	hsa-miR-668	CLIP-seq
MIRT2623042	hsa-miR-769-5p	CLIP-seq
MIRT2328153	hsa-miR-876-5p	CLIP-seq
MIRT2103994	hsa-miR-891b	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21719704, 27956147
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11390434
GO:0007165	Process	Signal transduction	TAS	9837776
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0042113	Process	B cell activation	IEA

MIM	HGNC	e!Ensembl
605215	15687	ENSG00000005020

O75563

Protein name

Src kinase-associated phosphoprotein 2 (Pyk2/RAFTK-associated protein) (Retinoic acid-induced protein 70) (SKAP55 homolog) (SKAP-55HOM) (SKAP-HOM) (Src family-associated phosphoprotein 2) (Src kinase-associated phosphoprotein 55-related protein) (Src-asso

Protein function

May be involved in B-cell and macrophage adhesion processes. In B-cells, may act by coupling the B-cell receptor (BCR) to integrin activation. May play a role in src signaling pathway.

PDB

3OMH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	117 → 219	PH domain	Domain
PF00018	SH3_1	305 → 350	SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Present in platelets (at protein level). {ECO:0000269|PubMed:10942756, ECO:0000269|PubMed:9755858, ECO:0000269|PubMed:9837776}.

Sequence

MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYL
QEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDV
DHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYAN
FYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI

Sequence length

359

Interactions

View interactions

	KEGG		Reactome
	Yersinia infection		Signal regulatory protein family interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC VENOUS INSUFFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	17952125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	18092319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17952125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34172489, 34989154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26577701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17952125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	GWASCAT_DG	28374850		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	23128233, 26192919, 26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31523167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34172489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21270831, 31455420, 34172489, 34556755, 34989154, 36150053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	19430480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	19430480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24756644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32398790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	28183734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24756644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26577701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24310616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20520718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	26577701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25862907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31398683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31523167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	37433170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	31290022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24310616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	31398683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29555213, 29996973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33350444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SKAP2 (src kinase associated phosphoprotein 2)