MBD4 (methyl-CpG binding domain 4, DNA glycosylase)

Gene

• Entrez ID: 8930
• Gene name: Methyl-CpG binding domain 4, DNA glycosylase
• Gene symbol: MBD4
• Synonyms (NCBI Gene): MED1, TPDS2, UVM1
• Chromosome: 3
• Chromosome location: 3q21.3
• Summary: The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcriptio

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT473395	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT473394	hsa-miR-4779	PAR-CLIP	20371350
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT473388	hsa-miR-3148	PAR-CLIP	20371350
MIRT473389	hsa-miR-4434	PAR-CLIP	20371350
MIRT473387	hsa-miR-4516	PAR-CLIP	20371350
MIRT473386	hsa-miR-5703	PAR-CLIP	20371350
MIRT473385	hsa-miR-765	PAR-CLIP	20371350
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	20371350
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	20371350
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	20371350
MIRT473379	hsa-miR-3175	PAR-CLIP	20371350
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT473377	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT473395	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT473394	hsa-miR-4779	PAR-CLIP	20371350
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT473388	hsa-miR-3148	PAR-CLIP	20371350
MIRT473389	hsa-miR-4434	PAR-CLIP	20371350
MIRT473387	hsa-miR-4516	PAR-CLIP	20371350
MIRT473386	hsa-miR-5703	PAR-CLIP	20371350
MIRT473385	hsa-miR-765	PAR-CLIP	20371350
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	20371350
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	20371350
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	20371350
MIRT473379	hsa-miR-3175	PAR-CLIP	20371350
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT473377	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT501922	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT501921	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT501920	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT501919	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT501918	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT501917	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT501916	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT556148	hsa-miR-500a-5p	PAR-CLIP	21572407
MIRT501915	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT501914	hsa-miR-499b-5p	PAR-CLIP	21572407
MIRT501913	hsa-miR-4289	PAR-CLIP	21572407
MIRT556147	hsa-miR-486-5p	PAR-CLIP	21572407
MIRT501912	hsa-miR-3166	PAR-CLIP	21572407
MIRT501911	hsa-miR-4771	PAR-CLIP	21572407
MIRT501910	hsa-miR-3190-3p	PAR-CLIP	21572407
MIRT501909	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT501908	hsa-miR-6833-5p	PAR-CLIP	21572407
MIRT501907	hsa-miR-4752	PAR-CLIP	21572407
MIRT547464	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT547463	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT547462	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT547461	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT547460	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT547459	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT547458	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT547457	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT547456	hsa-miR-634	PAR-CLIP	21572407
MIRT547455	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT547453	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT547454	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547452	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547451	hsa-miR-1226-3p	PAR-CLIP	21572407
MIRT547450	hsa-miR-922	PAR-CLIP	21572407
MIRT547449	hsa-miR-4530	PAR-CLIP	21572407
MIRT547448	hsa-miR-617	PAR-CLIP	21572407
MIRT547447	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT547446	hsa-miR-298	PAR-CLIP	21572407
MIRT547445	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547444	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT547464	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT547463	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT547462	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT547461	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT547460	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT547459	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT547458	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT547457	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT547456	hsa-miR-634	PAR-CLIP	21572407
MIRT547455	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT547453	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT547454	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547452	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547451	hsa-miR-1226-3p	PAR-CLIP	21572407
MIRT547450	hsa-miR-922	PAR-CLIP	21572407
MIRT547449	hsa-miR-4530	PAR-CLIP	21572407
MIRT547448	hsa-miR-617	PAR-CLIP	21572407
MIRT547447	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT547446	hsa-miR-298	PAR-CLIP	21572407
MIRT547445	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547444	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT501922	hsa-miR-146a-5p	PAR-CLIP	24398324
MIRT501921	hsa-miR-146b-5p	PAR-CLIP	24398324
MIRT501920	hsa-miR-7153-5p	PAR-CLIP	24398324
MIRT501919	hsa-miR-96-5p	PAR-CLIP	24398324
MIRT501918	hsa-miR-183-5p	PAR-CLIP	24398324
MIRT501917	hsa-miR-1271-5p	PAR-CLIP	24398324
MIRT501916	hsa-miR-182-5p	PAR-CLIP	24398324
MIRT501915	hsa-miR-6888-5p	PAR-CLIP	24398324
MIRT501914	hsa-miR-499b-5p	PAR-CLIP	24398324
MIRT501913	hsa-miR-4289	PAR-CLIP	24398324
MIRT501912	hsa-miR-3166	PAR-CLIP	24398324
MIRT501911	hsa-miR-4771	PAR-CLIP	24398324
MIRT501910	hsa-miR-3190-3p	PAR-CLIP	24398324
MIRT501909	hsa-miR-1273h-3p	PAR-CLIP	24398324
MIRT501908	hsa-miR-6833-5p	PAR-CLIP	24398324
MIRT501907	hsa-miR-4752	PAR-CLIP	24398324
MIRT473395	hsa-miR-651-3p	PAR-CLIP	24398324
MIRT473394	hsa-miR-4779	PAR-CLIP	24398324
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	24398324
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	24398324
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	24398324
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	24398324
MIRT473388	hsa-miR-3148	PAR-CLIP	24398324
MIRT473389	hsa-miR-4434	PAR-CLIP	24398324
MIRT473387	hsa-miR-4516	PAR-CLIP	24398324
MIRT473386	hsa-miR-5703	PAR-CLIP	24398324
MIRT473385	hsa-miR-765	PAR-CLIP	24398324
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	24398324
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	24398324
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	24398324
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	24398324
MIRT473379	hsa-miR-3175	PAR-CLIP	24398324
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT473377	hsa-miR-486-3p	PAR-CLIP	24398324
MIRT473395	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT473394	hsa-miR-4779	PAR-CLIP	23592263
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473388	hsa-miR-3148	PAR-CLIP	23592263
MIRT473389	hsa-miR-4434	PAR-CLIP	23592263
MIRT473387	hsa-miR-4516	PAR-CLIP	23592263
MIRT473386	hsa-miR-5703	PAR-CLIP	23592263
MIRT473385	hsa-miR-765	PAR-CLIP	23592263
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT473379	hsa-miR-3175	PAR-CLIP	23592263
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT473377	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT473395	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT473394	hsa-miR-4779	PAR-CLIP	23592263
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473388	hsa-miR-3148	PAR-CLIP	23592263
MIRT473389	hsa-miR-4434	PAR-CLIP	23592263
MIRT473387	hsa-miR-4516	PAR-CLIP	23592263
MIRT473386	hsa-miR-5703	PAR-CLIP	23592263
MIRT473385	hsa-miR-765	PAR-CLIP	23592263
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT473379	hsa-miR-3175	PAR-CLIP	23592263
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT473377	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT727238	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727237	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT473395	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT473394	hsa-miR-4779	PAR-CLIP	20371350
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT473388	hsa-miR-3148	PAR-CLIP	20371350
MIRT473389	hsa-miR-4434	PAR-CLIP	20371350
MIRT473387	hsa-miR-4516	PAR-CLIP	20371350
MIRT473386	hsa-miR-5703	PAR-CLIP	20371350
MIRT473385	hsa-miR-765	PAR-CLIP	20371350
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	20371350
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	20371350
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	20371350
MIRT473379	hsa-miR-3175	PAR-CLIP	20371350
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT473377	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT473395	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT473394	hsa-miR-4779	PAR-CLIP	20371350
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT473388	hsa-miR-3148	PAR-CLIP	20371350
MIRT473389	hsa-miR-4434	PAR-CLIP	20371350
MIRT473387	hsa-miR-4516	PAR-CLIP	20371350
MIRT473386	hsa-miR-5703	PAR-CLIP	20371350
MIRT473385	hsa-miR-765	PAR-CLIP	20371350
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	20371350
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	20371350
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	20371350
MIRT473379	hsa-miR-3175	PAR-CLIP	20371350
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT473377	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT501922	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT501921	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT501920	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT501919	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT501918	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT501917	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT501916	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT556148	hsa-miR-500a-5p	PAR-CLIP	21572407
MIRT501915	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT501914	hsa-miR-499b-5p	PAR-CLIP	21572407
MIRT501913	hsa-miR-4289	PAR-CLIP	21572407
MIRT556147	hsa-miR-486-5p	PAR-CLIP	21572407
MIRT501912	hsa-miR-3166	PAR-CLIP	21572407
MIRT501911	hsa-miR-4771	PAR-CLIP	21572407
MIRT501910	hsa-miR-3190-3p	PAR-CLIP	21572407
MIRT501909	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT501908	hsa-miR-6833-5p	PAR-CLIP	21572407
MIRT501907	hsa-miR-4752	PAR-CLIP	21572407
MIRT547464	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT547463	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT547462	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT547461	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT547460	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT547459	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT547458	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT547457	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT547456	hsa-miR-634	PAR-CLIP	21572407
MIRT547455	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT547453	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT547454	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547452	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547451	hsa-miR-1226-3p	PAR-CLIP	21572407
MIRT547450	hsa-miR-922	PAR-CLIP	21572407
MIRT547449	hsa-miR-4530	PAR-CLIP	21572407
MIRT547448	hsa-miR-617	PAR-CLIP	21572407
MIRT547447	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT547446	hsa-miR-298	PAR-CLIP	21572407
MIRT547445	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547444	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT547464	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT547463	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT547462	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT547461	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT547460	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT547459	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT547458	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT547457	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT547456	hsa-miR-634	PAR-CLIP	21572407
MIRT547455	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT547453	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT547454	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547452	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547451	hsa-miR-1226-3p	PAR-CLIP	21572407
MIRT547450	hsa-miR-922	PAR-CLIP	21572407
MIRT547449	hsa-miR-4530	PAR-CLIP	21572407
MIRT547448	hsa-miR-617	PAR-CLIP	21572407
MIRT547447	hsa-miR-6505-3p	PAR-CLIP	21572407
MIRT547446	hsa-miR-298	PAR-CLIP	21572407
MIRT547445	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547444	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT501922	hsa-miR-146a-5p	PAR-CLIP	24398324
MIRT501921	hsa-miR-146b-5p	PAR-CLIP	24398324
MIRT501920	hsa-miR-7153-5p	PAR-CLIP	24398324
MIRT501919	hsa-miR-96-5p	PAR-CLIP	24398324
MIRT501918	hsa-miR-183-5p	PAR-CLIP	24398324
MIRT501917	hsa-miR-1271-5p	PAR-CLIP	24398324
MIRT501916	hsa-miR-182-5p	PAR-CLIP	24398324
MIRT501915	hsa-miR-6888-5p	PAR-CLIP	24398324
MIRT501914	hsa-miR-499b-5p	PAR-CLIP	24398324
MIRT501913	hsa-miR-4289	PAR-CLIP	24398324
MIRT501912	hsa-miR-3166	PAR-CLIP	24398324
MIRT501911	hsa-miR-4771	PAR-CLIP	24398324
MIRT501910	hsa-miR-3190-3p	PAR-CLIP	24398324
MIRT501909	hsa-miR-1273h-3p	PAR-CLIP	24398324
MIRT501908	hsa-miR-6833-5p	PAR-CLIP	24398324
MIRT501907	hsa-miR-4752	PAR-CLIP	24398324
MIRT473395	hsa-miR-651-3p	PAR-CLIP	24398324
MIRT473394	hsa-miR-4779	PAR-CLIP	24398324
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	24398324
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	24398324
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	24398324
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	24398324
MIRT473388	hsa-miR-3148	PAR-CLIP	24398324
MIRT473389	hsa-miR-4434	PAR-CLIP	24398324
MIRT473387	hsa-miR-4516	PAR-CLIP	24398324
MIRT473386	hsa-miR-5703	PAR-CLIP	24398324
MIRT473385	hsa-miR-765	PAR-CLIP	24398324
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	24398324
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	24398324
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	24398324
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	24398324
MIRT473379	hsa-miR-3175	PAR-CLIP	24398324
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT473377	hsa-miR-486-3p	PAR-CLIP	24398324
MIRT473395	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT473394	hsa-miR-4779	PAR-CLIP	23592263
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473388	hsa-miR-3148	PAR-CLIP	23592263
MIRT473389	hsa-miR-4434	PAR-CLIP	23592263
MIRT473387	hsa-miR-4516	PAR-CLIP	23592263
MIRT473386	hsa-miR-5703	PAR-CLIP	23592263
MIRT473385	hsa-miR-765	PAR-CLIP	23592263
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT473379	hsa-miR-3175	PAR-CLIP	23592263
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT473377	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT473395	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT473394	hsa-miR-4779	PAR-CLIP	23592263
MIRT473393	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT473392	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT473391	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473390	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473388	hsa-miR-3148	PAR-CLIP	23592263
MIRT473389	hsa-miR-4434	PAR-CLIP	23592263
MIRT473387	hsa-miR-4516	PAR-CLIP	23592263
MIRT473386	hsa-miR-5703	PAR-CLIP	23592263
MIRT473385	hsa-miR-765	PAR-CLIP	23592263
MIRT473384	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT473383	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT473382	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT473380	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT473381	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT473379	hsa-miR-3175	PAR-CLIP	23592263
MIRT473378	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT473377	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT1135081	hsa-miR-1245b-3p	CLIP-seq
MIRT1135082	hsa-miR-1271	CLIP-seq
MIRT1135083	hsa-miR-129-5p	CLIP-seq
MIRT1135084	hsa-miR-130a	CLIP-seq
MIRT1135085	hsa-miR-130b	CLIP-seq
MIRT1135086	hsa-miR-181a	CLIP-seq
MIRT1135087	hsa-miR-181b	CLIP-seq
MIRT1135088	hsa-miR-181c	CLIP-seq
MIRT1135089	hsa-miR-181d	CLIP-seq
MIRT1135090	hsa-miR-199a-3p	CLIP-seq
MIRT1135091	hsa-miR-199b-3p	CLIP-seq
MIRT1135092	hsa-miR-19a	CLIP-seq
MIRT1135093	hsa-miR-19b	CLIP-seq
MIRT1135094	hsa-miR-301a	CLIP-seq
MIRT1135095	hsa-miR-301b	CLIP-seq
MIRT1135096	hsa-miR-3129-5p	CLIP-seq
MIRT1135097	hsa-miR-3616-5p	CLIP-seq
MIRT1135098	hsa-miR-3647-5p	CLIP-seq
MIRT1135099	hsa-miR-3653	CLIP-seq
MIRT1135100	hsa-miR-3658	CLIP-seq
MIRT1135101	hsa-miR-3666	CLIP-seq
MIRT1135102	hsa-miR-4262	CLIP-seq
MIRT1135103	hsa-miR-4295	CLIP-seq
MIRT1135104	hsa-miR-454	CLIP-seq
MIRT1135105	hsa-miR-4704-5p	CLIP-seq
MIRT1135106	hsa-miR-4795-5p	CLIP-seq
MIRT1135107	hsa-miR-518a-5p	CLIP-seq
MIRT1135108	hsa-miR-519a	CLIP-seq
MIRT1135109	hsa-miR-519b-3p	CLIP-seq
MIRT1135110	hsa-miR-519c-3p	CLIP-seq
MIRT1135111	hsa-miR-527	CLIP-seq
MIRT1135112	hsa-miR-548p	CLIP-seq
MIRT1135113	hsa-miR-573	CLIP-seq
MIRT1135114	hsa-miR-586	CLIP-seq
MIRT1135115	hsa-miR-603	CLIP-seq
MIRT1135116	hsa-miR-936	CLIP-seq
MIRT1135117	hsa-miR-96	CLIP-seq
MIRT2038385	hsa-miR-122	CLIP-seq
MIRT2038386	hsa-miR-1273g	CLIP-seq
MIRT2038387	hsa-miR-135a	CLIP-seq
MIRT2038388	hsa-miR-135b	CLIP-seq
MIRT2038389	hsa-miR-216b	CLIP-seq
MIRT2038390	hsa-miR-2681	CLIP-seq
MIRT2038391	hsa-miR-323b-5p	CLIP-seq
MIRT2038392	hsa-miR-3613-5p	CLIP-seq
MIRT2038393	hsa-miR-3622b-5p	CLIP-seq
MIRT2038394	hsa-miR-3652	CLIP-seq
MIRT2038395	hsa-miR-3675-3p	CLIP-seq
MIRT2038396	hsa-miR-3978	CLIP-seq
MIRT2038397	hsa-miR-4430	CLIP-seq
MIRT2038398	hsa-miR-4463	CLIP-seq
MIRT2038399	hsa-miR-4494	CLIP-seq
MIRT2038400	hsa-miR-4505	CLIP-seq
MIRT2038401	hsa-miR-4668-3p	CLIP-seq
MIRT2038402	hsa-miR-875-3p	CLIP-seq
MIRT2038403	hsa-miR-876-3p	CLIP-seq
MIRT2038385	hsa-miR-122	CLIP-seq
MIRT1135082	hsa-miR-1271	CLIP-seq
MIRT2038386	hsa-miR-1273g	CLIP-seq
MIRT2038387	hsa-miR-135a	CLIP-seq
MIRT2038388	hsa-miR-135b	CLIP-seq
MIRT2268253	hsa-miR-1587	CLIP-seq
MIRT2038389	hsa-miR-216b	CLIP-seq
MIRT2038390	hsa-miR-2681	CLIP-seq
MIRT2268254	hsa-miR-3147	CLIP-seq
MIRT2038393	hsa-miR-3622b-5p	CLIP-seq
MIRT2038394	hsa-miR-3652	CLIP-seq
MIRT1135099	hsa-miR-3653	CLIP-seq
MIRT1135100	hsa-miR-3658	CLIP-seq
MIRT2038395	hsa-miR-3675-3p	CLIP-seq
MIRT2038396	hsa-miR-3978	CLIP-seq
MIRT2268255	hsa-miR-4259	CLIP-seq
MIRT2038397	hsa-miR-4430	CLIP-seq
MIRT2038398	hsa-miR-4463	CLIP-seq
MIRT2038399	hsa-miR-4494	CLIP-seq
MIRT2038400	hsa-miR-4505	CLIP-seq
MIRT2038401	hsa-miR-4668-3p	CLIP-seq
MIRT2268256	hsa-miR-4674	CLIP-seq
MIRT1135105	hsa-miR-4704-5p	CLIP-seq
MIRT2268257	hsa-miR-4715-5p	CLIP-seq
MIRT1135115	hsa-miR-603	CLIP-seq
MIRT2268258	hsa-miR-645	CLIP-seq
MIRT2038402	hsa-miR-875-3p	CLIP-seq
MIRT2038403	hsa-miR-876-3p	CLIP-seq
MIRT1135117	hsa-miR-96	CLIP-seq
MIRT2390668	hsa-miR-1182	CLIP-seq
MIRT2038385	hsa-miR-122	CLIP-seq
MIRT2390669	hsa-miR-24	CLIP-seq
MIRT2038390	hsa-miR-2681	CLIP-seq
MIRT2038393	hsa-miR-3622b-5p	CLIP-seq
MIRT2390670	hsa-miR-3672	CLIP-seq
MIRT2390671	hsa-miR-4284	CLIP-seq
MIRT2390672	hsa-miR-4420	CLIP-seq
MIRT2038398	hsa-miR-4463	CLIP-seq
MIRT2038399	hsa-miR-4494	CLIP-seq
MIRT2390673	hsa-miR-4786-3p	CLIP-seq
MIRT2038385	hsa-miR-122	CLIP-seq
MIRT2038393	hsa-miR-3622b-5p	CLIP-seq
MIRT2038398	hsa-miR-4463	CLIP-seq
MIRT2038399	hsa-miR-4494	CLIP-seq
MIRT2684706	hsa-miR-3920	CLIP-seq
MIRT2038396	hsa-miR-3978	CLIP-seq
MIRT2684707	hsa-miR-4762-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003696	Function	Satellite DNA binding	TAS	9774669
GO:0003824	Function	Catalytic activity	IEA
GO:0004520	Function	DNA endonuclease activity	TAS	10097147
GO:0005515	Function	Protein binding	IPI	12702765, 23275563, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9774669
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	10097147
GO:0006974	Process	DNA damage response	IEA
GO:0008263	Function	Pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IDA	14614141
GO:0008263	Function	Pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019104	Function	DNA N-glycosylase activity	TAS
GO:0032355	Process	Response to estradiol	IEA
GO:0045008	Process	Depyrimidination	TAS

Other IDs

• MIM: 603574
• HGNC: 6919
• e!Ensembl: ENSG00000129071

Protein

• UniProt ID: O95243
• Protein name: Methyl-CpG-binding domain protein 4 (EC 3.2.2.-) (Methyl-CpG-binding endonuclease 1) (Methyl-CpG-binding protein MBD4) (Mismatch-specific DNA N-glycosylase)
• Protein function: Mismatch-specific DNA N-glycosylase involved in DNA repair. Has thymine glycosylase activity and is specific for G:T mismatches within methylated and unmethylated CpG sites. Can also remove uracil or 5-fluorouracil in G:U mismatches. Has no lyas
• PDB: 2MOE, 3IHO, 4DK9, 4E9E, 4E9F, 4E9G, 4E9H, 4EA4, 4EA5, 4LG7, 4OFA, 4OFE, 4OFH, 5CHZ, 6VJW, 7KZ0, 7KZ1, 7KZG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01429	MBD	76 → 151	Methyl-CpG binding domain	Domain

• Sequence:

  MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSE
  CNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRS
  KSSLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRT
  RSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKG
  IPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETL
  SVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGT
  KVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSS
  KYNKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWK
  FLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKY
  GNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS

• Sequence length: 580

Pathways

KEGG:

Base excision repair

Reactome:

Recognition and association of DNA glycosylase with site containing an affected pyrimidine
Cleavage of the damaged pyrimidine
Displacement of DNA glycosylase by APEX1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
MBD4-related disorder	Likely pathogenic; Pathogenic	rs778697654, rs769552413, rs769076971, rs558765093, rs897132425	RCV004757536 RCV004757594 RCV004757598 RCV003981042 RCV003896710	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Melanoma, uveal, susceptibility to, 1	Likely pathogenic; Pathogenic	rs558765093, rs778697654, rs200758755	RCV005023267 RCV002274499 RCV002274502	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian serous cystadenocarcinoma	Likely pathogenic; Pathogenic	rs778697654	RCV005930210	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Tumor predisposition syndrome 2	Likely pathogenic; Pathogenic	rs558765093, rs778697654, rs148098584, rs200758755, rs1559801181	RCV002274219 RCV002274500 RCV002274501 RCV002274503 RCV002274504	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Uveal melanoma	Likely pathogenic; Pathogenic	rs778697654	RCV005930209	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTI-TOPOISOMERASE-I-ANTIBODY-POSITIVE SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer-predisposing syndrome	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28412148		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30049810		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16601283, 16803845		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16803845		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16601283		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	23538858		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16831587		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15613457		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31001930		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31001930	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31001930		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28642237		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	31619474		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28642237		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	40113094	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	19921286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	19921286	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Atresia	Biliary Atresia	BEFREE	21857377		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28291257	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28367434, 28848075		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10485914, 15989967, 21454576, 22964581, 23936234, 29473320, 30087366, 31090264		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10485914, 15989967, 19183483, 20160030, 21288332, 22345290, 22964581, 27506935, 27966906, 29473320, 30087366	Associate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28256743		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10934138, 23027038, 35131256	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12935920		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35069777	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	24292451	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28367434, 28848075		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16803845, 18495292, 21739480, 28367434		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37525498	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36302831	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28159809		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23027038		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23027038		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17285135, 18162445, 27086921		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	18162445		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18162445		★☆☆☆☆ Found in Text Mining only
Color Blindness, Red-Green	Color blindness	BEFREE	8104869		★☆☆☆☆ Found in Text Mining only
Colorectal Adenomatous Polyposis Autosomal Recessive	Colorectal adenomatous polyposis	Pubtator	35460607	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11104560, 12926109, 17285135, 18097604, 19127118, 19469655, 26503472, 28740336, 29545913, 31322271		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11104560, 17285135, 19127118, 26130665, 37402954, 37957685	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17285135		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26503472		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28065745		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	21857377		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19787250		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	22138541		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16934225		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	16934225		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10854253		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	37402954	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	37402954	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	27868291		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11836615		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	11836615		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	27744583	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplastic polyposis syndrome	Hyperplastic Polyposis Syndrome	BEFREE	16831587		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	20100009, 21377502		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	35460607	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33542097	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20501850, 30049810, 35460607	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17982626, 20501850, 30049810		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11230735, 30723918		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	20007298		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	34612778	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18495292		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24871463	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29018507, 36748375	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17360956, 17893979, 19444718, 24871463, 29018507		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26130665, 31348270	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10485914, 15989967, 21454576, 22964581, 23936234, 29187405, 29473320, 30087366, 31090264		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19787250		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19469655		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16803845, 18495292, 21739480, 28367434		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11267993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17483314, 22869146, 23538858, 28367434, 30867757, 31676563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12430186, 19469655		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28367434, 28848075		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11267993, 11836615, 17285135, 19469655, 27086921, 29300860, 30049810, 31322271, 31476572		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23027038		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10637515, 12430186, 17285135, 27086921		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10485914		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	12926109		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	19179424	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19243021, 27340176, 28367434		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31695025	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35131256	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11267993, 12430186, 12926109, 12935920, 19127118, 19243021, 22342682, 22869146, 22964581, 23538858, 23936234, 24026530, 25391423, 26503472, 26910888, 27086921, 28045951, 28848075, 29187405, 29760383, 30714079, 30867757, 31676563		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12101420, 22342682		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	18925411		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24969180		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37525498	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19127118, 37525498	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19127118	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11267993		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32367578	Associate	★☆☆☆☆ Found in Text Mining only
Paragangliomas 3	Paraganglioma	Pubtator	32239153	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22083667		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	31591497	Associate	★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	8004675		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	21399635		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22869146, 23538858, 28367434, 30867757, 31676563		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25481872, 31348270, 31501863, 36535377	Associate	★☆☆☆☆ Found in Text Mining only
Protanomaly	Protanomaly	BEFREE	28256743		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20676650, 22505706		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary syndrome	Pubtator	28489605	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15205355, 25162968		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12430186		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17229543, 37800836	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16926188		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19444718		★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	36191835	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26735014		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	27115207	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	10637515, 12935920, 29545913		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28848075	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23027038	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29760383, 30714079		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Uveal melanoma	Uveal melanoma	Pubtator	29760383, 32239153, 32415113, 35460607, 37402954	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)