Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8916
Gene name	HECT and RLD domain containing E3 ubiquitin protein ligase 3
Gene symbol	HERC3
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q22.1
Summary	This gene encodes a member the HERC ubiquitin ligase family. The encoded protein is located in the cytosol and binds ubiquitin via a HECT domain. Mutations in this gene have been associated with colorectal and gastric carcinomas. Alternatively spliced tra

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025153	hsa-miR-181a-5p	Microarray	17612493
MIRT046255	hsa-miR-23b-3p	CLASH	23622248
MIRT1044341	hsa-miR-137	CLIP-seq
MIRT1044342	hsa-miR-153	CLIP-seq
MIRT1044343	hsa-miR-25	CLIP-seq
MIRT1044344	hsa-miR-3122	CLIP-seq
MIRT1044345	hsa-miR-3153	CLIP-seq
MIRT1044346	hsa-miR-32	CLIP-seq
MIRT1044347	hsa-miR-338-5p	CLIP-seq
MIRT1044348	hsa-miR-3545-3p	CLIP-seq
MIRT1044349	hsa-miR-363	CLIP-seq
MIRT1044350	hsa-miR-367	CLIP-seq
MIRT1044351	hsa-miR-3913-5p	CLIP-seq
MIRT1044352	hsa-miR-3976	CLIP-seq
MIRT1044353	hsa-miR-432	CLIP-seq
MIRT1044354	hsa-miR-448	CLIP-seq
MIRT1044355	hsa-miR-4520a-3p	CLIP-seq
MIRT1044356	hsa-miR-4520b-3p	CLIP-seq
MIRT1044357	hsa-miR-4668-5p	CLIP-seq
MIRT1044358	hsa-miR-4795-3p	CLIP-seq
MIRT1044359	hsa-miR-4799-5p	CLIP-seq
MIRT1044360	hsa-miR-5096	CLIP-seq
MIRT1044361	hsa-miR-513a-3p	CLIP-seq
MIRT1044362	hsa-miR-548a-5p	CLIP-seq
MIRT1044363	hsa-miR-548ab	CLIP-seq
MIRT1044364	hsa-miR-548ak	CLIP-seq
MIRT1044365	hsa-miR-548b-5p	CLIP-seq
MIRT1044366	hsa-miR-548c-5p	CLIP-seq
MIRT1044367	hsa-miR-548d-5p	CLIP-seq
MIRT1044368	hsa-miR-548h	CLIP-seq
MIRT1044369	hsa-miR-548i	CLIP-seq
MIRT1044370	hsa-miR-548j	CLIP-seq
MIRT1044371	hsa-miR-548w	CLIP-seq
MIRT1044372	hsa-miR-548y	CLIP-seq
MIRT1044373	hsa-miR-559	CLIP-seq
MIRT1044374	hsa-miR-561	CLIP-seq
MIRT1044375	hsa-miR-577	CLIP-seq
MIRT1044376	hsa-miR-578	CLIP-seq
MIRT1044377	hsa-miR-622	CLIP-seq
MIRT1044378	hsa-miR-92a	CLIP-seq
MIRT1044379	hsa-miR-92b	CLIP-seq
MIRT2009655	hsa-miR-1238	CLIP-seq
MIRT2009656	hsa-miR-1910	CLIP-seq
MIRT2009657	hsa-miR-3121-5p	CLIP-seq
MIRT2009658	hsa-miR-3124-3p	CLIP-seq
MIRT2009659	hsa-miR-3673	CLIP-seq
MIRT2009660	hsa-miR-3908	CLIP-seq
MIRT2009661	hsa-miR-3942-5p	CLIP-seq
MIRT2009662	hsa-miR-4691-5p	CLIP-seq
MIRT2009663	hsa-miR-4703-5p	CLIP-seq
MIRT2009664	hsa-miR-4766-3p	CLIP-seq
MIRT2009665	hsa-miR-548ac	CLIP-seq
MIRT2009666	hsa-miR-548ae	CLIP-seq
MIRT2009667	hsa-miR-548aj	CLIP-seq
MIRT2009668	hsa-miR-548am	CLIP-seq
MIRT2009669	hsa-miR-548d-3p	CLIP-seq
MIRT2009670	hsa-miR-548x	CLIP-seq
MIRT2009671	hsa-miR-548z	CLIP-seq
MIRT2241933	hsa-miR-130a	CLIP-seq
MIRT2241934	hsa-miR-130b	CLIP-seq
MIRT2241935	hsa-miR-181a	CLIP-seq
MIRT2241936	hsa-miR-181b	CLIP-seq
MIRT2241937	hsa-miR-181c	CLIP-seq
MIRT2241938	hsa-miR-181d	CLIP-seq
MIRT2241939	hsa-miR-301a	CLIP-seq
MIRT2241940	hsa-miR-301b	CLIP-seq
MIRT2241941	hsa-miR-3177-5p	CLIP-seq
MIRT2241942	hsa-miR-338-3p	CLIP-seq
MIRT2241943	hsa-miR-3666	CLIP-seq
MIRT2009659	hsa-miR-3673	CLIP-seq
MIRT2241944	hsa-miR-3691-3p	CLIP-seq
MIRT2009660	hsa-miR-3908	CLIP-seq
MIRT2009661	hsa-miR-3942-5p	CLIP-seq
MIRT2241945	hsa-miR-4262	CLIP-seq
MIRT2241946	hsa-miR-4295	CLIP-seq
MIRT2241947	hsa-miR-4457	CLIP-seq
MIRT2241948	hsa-miR-4530	CLIP-seq
MIRT2241949	hsa-miR-454	CLIP-seq
MIRT2009663	hsa-miR-4703-5p	CLIP-seq
MIRT2009664	hsa-miR-4766-3p	CLIP-seq
MIRT2241950	hsa-miR-4797-5p	CLIP-seq
MIRT2241951	hsa-miR-513b	CLIP-seq
MIRT2241952	hsa-miR-759	CLIP-seq
MIRT2241953	hsa-miR-922	CLIP-seq
MIRT2451129	hsa-miR-4668-3p	CLIP-seq
MIRT2451130	hsa-miR-548c-3p	CLIP-seq
MIRT1044374	hsa-miR-561	CLIP-seq
MIRT2545646	hsa-miR-1283	CLIP-seq
MIRT2009659	hsa-miR-3673	CLIP-seq
MIRT2009660	hsa-miR-3908	CLIP-seq
MIRT2009661	hsa-miR-3942-5p	CLIP-seq
MIRT2009663	hsa-miR-4703-5p	CLIP-seq
MIRT2009664	hsa-miR-4766-3p	CLIP-seq
MIRT2009665	hsa-miR-548ac	CLIP-seq
MIRT2009666	hsa-miR-548ae	CLIP-seq
MIRT2009667	hsa-miR-548aj	CLIP-seq
MIRT2009668	hsa-miR-548am	CLIP-seq
MIRT2451130	hsa-miR-548c-3p	CLIP-seq
MIRT2009669	hsa-miR-548d-3p	CLIP-seq
MIRT2545647	hsa-miR-548p	CLIP-seq
MIRT2009670	hsa-miR-548x	CLIP-seq
MIRT2009671	hsa-miR-548z	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781, 35637966
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
605200	4876	ENSG00000138641

Q15034

Protein name

Probable E3 ubiquitin-protein ligase HERC3 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 3) (HECT-type E3 ubiquitin transferase HERC3)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00415	RCC1	52 → 99	Regulator of chromosome condensation (RCC1) repeat	Repeat
PF00415	RCC1	102 → 152	Regulator of chromosome condensation (RCC1) repeat	Repeat
PF00415	RCC1	155 → 205	Regulator of chromosome condensation (RCC1) repeat	Repeat
PF00415	RCC1	208 → 257	Regulator of chromosome condensation (RCC1) repeat	Repeat
PF00415	RCC1	260 → 309	Regulator of chromosome condensation (RCC1) repeat	Repeat
PF00415	RCC1	313 → 377	Regulator of chromosome condensation (RCC1) repeat	Repeat
PF00632	HECT	752 → 1050	HECT-domain (ubiquitin-transferase)	Domain

Sequence

MLCWGYWSLGQPGISTNLQGIVAEPQVCGFISDRSVKEVACGGNHSVFLLEDGEVYTCGL
NTKGQLGHEREGNKPEQIGALADQHIIHVACGESHSLALSDRGQLFSWGAGSDGQLGLMT
TEDSVAVPRLIQKLNQQTILQVSCGNWHCLALAADGQFFTWGKNSHGQLGLGKEFPSQAS
PQRVRSLEGIPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR
TQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRRVLELMGSEVTQIA
CGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTCNVKCPSPVKGYWAAHSGQLSARADRFK
YHIVKQIFSGGDQTFVLCSKYENYSPAVDFRTMNQAHYTSLINDETIAVWRQKLSEHNNA
NTINGVVQILSSAACWNGSFLEKKIDEHFKTSPKIPGIDLNSTRVLFEKLMNSQHSMILE
QILNSFESCLIPQLSSSPPDVEAMRIYLILPEFPLLQDSKYYITLTIPLAMAILRLDTNP
SKVLDNWWSQVCPKYFMKLVNLYKGAVLYLLRGRKTFLIPVLFNNYITAALKLLEKLYKV
NLKVKHVEYDTFYIPEISNLVDIQEDYLMWFLHQAGMKARPSIIQDTVTLCSYPFIFDAQ
AKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNNLVGDALRELS
IHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSNLLWFSDT
CFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQE
LLDYPGEDVEETFCLNFTICRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQI
SVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHP
TVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMASLQIVIQSTASGEEYLPVAHTCYN
LLDLPKYSSKEILSARLTQALDNYEGFSLA

Sequence length

1050

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CYSTIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	29880857, 36598329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36598329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35064108	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35637966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★★★★★ ★☆☆☆☆ Found in Text Mining only

HERC3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3)