BCL10 (BCL10 immune signaling adaptor)

Gene

• Entrez ID: 8915
• Gene name: BCL10 immune signaling adaptor
• Gene symbol: BCL10
• Synonyms (NCBI Gene): CARMEN, CIPER, CLAP, IMD37, c-E10, mE10
• Chromosome: 1
• Chromosome location: 1p22.3
• Summary: This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB.

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918314	G>A,C	Pathogenic	Stop gained, missense variant, coding sequence variant
rs370432633	G>A	Pathogenic	Missense variant, coding sequence variant
rs387906350	A>-,AA	Pathogenic	Coding sequence variant, frameshift variant
rs387906351	T>-,TT	Pathogenic	Coding sequence variant, frameshift variant
rs587776630	->T	Pathogenic	Coding sequence variant, frameshift variant
rs587776631	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs587776632	A>-,AAA	Pathogenic	Coding sequence variant, frameshift variant
rs587776633	->T	Pathogenic	Coding sequence variant, frameshift variant
rs587776634	TGCCTACTTCTAGAACA>-	Pathogenic	Coding sequence variant, frameshift variant
rs587776635	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs587776636	->A	Pathogenic	Coding sequence variant, frameshift variant
rs587776637	TCT>-	Pathogenic	Coding sequence variant, inframe deletion

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019608	hsa-miR-340-5p	Sequencing	20371350
MIRT019968	hsa-miR-375	Microarray	20215506
MIRT028199	hsa-miR-33a-5p	Sequencing	20371350
MIRT048426	hsa-miR-100-5p	CLASH	23622248
MIRT053389	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	23807165
MIRT053389	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	23807165
MIRT669374	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT669373	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT669372	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT080491	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT669371	hsa-miR-197-5p	HITS-CLIP	23824327
MIRT669370	hsa-miR-3132	HITS-CLIP	23824327
MIRT669369	hsa-miR-3686	HITS-CLIP	23824327
MIRT669368	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT669367	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT669366	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT669365	hsa-miR-1229-5p	HITS-CLIP	23824327
MIRT669364	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT669363	hsa-miR-3122	HITS-CLIP	23824327
MIRT669362	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT669361	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT669360	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT290873	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT660339	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT660338	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT660337	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT290873	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT660339	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT660338	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT660337	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT733544	hsa-miR-155-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	32042774
MIRT669374	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT669373	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT669372	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT080491	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT669371	hsa-miR-197-5p	HITS-CLIP	23824327
MIRT669370	hsa-miR-3132	HITS-CLIP	23824327
MIRT669369	hsa-miR-3686	HITS-CLIP	23824327
MIRT669368	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT669367	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT669366	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT669365	hsa-miR-1229-5p	HITS-CLIP	23824327
MIRT669364	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT669363	hsa-miR-3122	HITS-CLIP	23824327
MIRT669362	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT669361	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT669360	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT290873	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT660339	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT660338	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT660337	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT290873	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT660339	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT660338	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT660337	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT818104	hsa-miR-105	CLIP-seq
MIRT818105	hsa-miR-1182	CLIP-seq
MIRT818106	hsa-miR-1273e	CLIP-seq
MIRT818107	hsa-miR-1294	CLIP-seq
MIRT818108	hsa-miR-129-5p	CLIP-seq
MIRT818109	hsa-miR-151-3p	CLIP-seq
MIRT818110	hsa-miR-2278	CLIP-seq
MIRT818111	hsa-miR-3121-3p	CLIP-seq
MIRT818112	hsa-miR-3155	CLIP-seq
MIRT818113	hsa-miR-3155b	CLIP-seq
MIRT818114	hsa-miR-320a	CLIP-seq
MIRT818115	hsa-miR-320b	CLIP-seq
MIRT818116	hsa-miR-320c	CLIP-seq
MIRT818117	hsa-miR-320d	CLIP-seq
MIRT818118	hsa-miR-3647-3p	CLIP-seq
MIRT818119	hsa-miR-3671	CLIP-seq
MIRT818120	hsa-miR-371-5p	CLIP-seq
MIRT818121	hsa-miR-371b-5p	CLIP-seq
MIRT818122	hsa-miR-384	CLIP-seq
MIRT818123	hsa-miR-3926	CLIP-seq
MIRT818124	hsa-miR-3976	CLIP-seq
MIRT818125	hsa-miR-4252	CLIP-seq
MIRT818126	hsa-miR-4261	CLIP-seq
MIRT818127	hsa-miR-4282	CLIP-seq
MIRT818128	hsa-miR-4307	CLIP-seq
MIRT818129	hsa-miR-4429	CLIP-seq
MIRT818130	hsa-miR-4433	CLIP-seq
MIRT818131	hsa-miR-4470	CLIP-seq
MIRT818132	hsa-miR-4486	CLIP-seq
MIRT818133	hsa-miR-4496	CLIP-seq
MIRT818134	hsa-miR-4517	CLIP-seq
MIRT818135	hsa-miR-451b	CLIP-seq
MIRT818136	hsa-miR-4635	CLIP-seq
MIRT818137	hsa-miR-4649-5p	CLIP-seq
MIRT818138	hsa-miR-4684-5p	CLIP-seq
MIRT818139	hsa-miR-4696	CLIP-seq
MIRT818140	hsa-miR-4710	CLIP-seq
MIRT818141	hsa-miR-4719	CLIP-seq
MIRT818142	hsa-miR-4793-3p	CLIP-seq
MIRT818143	hsa-miR-484	CLIP-seq
MIRT818144	hsa-miR-508-5p	CLIP-seq
MIRT818145	hsa-miR-513a-3p	CLIP-seq
MIRT818146	hsa-miR-513c	CLIP-seq
MIRT818147	hsa-miR-514b-5p	CLIP-seq
MIRT818148	hsa-miR-548c-3p	CLIP-seq
MIRT818149	hsa-miR-548p	CLIP-seq
MIRT818150	hsa-miR-548s	CLIP-seq
MIRT818151	hsa-miR-548u	CLIP-seq
MIRT818152	hsa-miR-582-5p	CLIP-seq
MIRT818153	hsa-miR-587	CLIP-seq
MIRT818154	hsa-miR-627	CLIP-seq
MIRT818155	hsa-miR-628-3p	CLIP-seq
MIRT818156	hsa-miR-661	CLIP-seq
MIRT818157	hsa-miR-665	CLIP-seq
MIRT818158	hsa-miR-766	CLIP-seq
MIRT818159	hsa-miR-873	CLIP-seq
MIRT818107	hsa-miR-1294	CLIP-seq
MIRT1545719	hsa-miR-187	CLIP-seq
MIRT818140	hsa-miR-4710	CLIP-seq
MIRT818104	hsa-miR-105	CLIP-seq
MIRT818110	hsa-miR-2278	CLIP-seq
MIRT1941833	hsa-miR-3163	CLIP-seq
MIRT1941834	hsa-miR-340	CLIP-seq
MIRT1941835	hsa-miR-3685	CLIP-seq
MIRT818123	hsa-miR-3926	CLIP-seq
MIRT818127	hsa-miR-4282	CLIP-seq
MIRT818131	hsa-miR-4470	CLIP-seq
MIRT1941836	hsa-miR-4474-5p	CLIP-seq
MIRT818132	hsa-miR-4486	CLIP-seq
MIRT1941837	hsa-miR-4495	CLIP-seq
MIRT818135	hsa-miR-451b	CLIP-seq
MIRT818137	hsa-miR-4649-5p	CLIP-seq
MIRT1941838	hsa-miR-4724-5p	CLIP-seq
MIRT1941839	hsa-miR-4760-5p	CLIP-seq
MIRT818142	hsa-miR-4793-3p	CLIP-seq
MIRT818144	hsa-miR-508-5p	CLIP-seq
MIRT818150	hsa-miR-548s	CLIP-seq
MIRT818151	hsa-miR-548u	CLIP-seq
MIRT818152	hsa-miR-582-5p	CLIP-seq
MIRT1941840	hsa-miR-603	CLIP-seq
MIRT818156	hsa-miR-661	CLIP-seq
MIRT818158	hsa-miR-766	CLIP-seq
MIRT818108	hsa-miR-129-5p	CLIP-seq
MIRT1545719	hsa-miR-187	CLIP-seq
MIRT818110	hsa-miR-2278	CLIP-seq
MIRT2180693	hsa-miR-24	CLIP-seq
MIRT2180694	hsa-miR-3174	CLIP-seq
MIRT2180695	hsa-miR-342-3p	CLIP-seq
MIRT2180696	hsa-miR-3606	CLIP-seq
MIRT2180697	hsa-miR-3622b-5p	CLIP-seq
MIRT818118	hsa-miR-3647-3p	CLIP-seq
MIRT818122	hsa-miR-384	CLIP-seq
MIRT818123	hsa-miR-3926	CLIP-seq
MIRT2180698	hsa-miR-3929	CLIP-seq
MIRT818125	hsa-miR-4252	CLIP-seq
MIRT2180699	hsa-miR-4255	CLIP-seq
MIRT818127	hsa-miR-4282	CLIP-seq
MIRT2180700	hsa-miR-4284	CLIP-seq
MIRT2180701	hsa-miR-4316	CLIP-seq
MIRT2180702	hsa-miR-4326	CLIP-seq
MIRT2180703	hsa-miR-4419b	CLIP-seq
MIRT818130	hsa-miR-4433	CLIP-seq
MIRT818131	hsa-miR-4470	CLIP-seq
MIRT1941836	hsa-miR-4474-5p	CLIP-seq
MIRT2180704	hsa-miR-4478	CLIP-seq
MIRT818132	hsa-miR-4486	CLIP-seq
MIRT818137	hsa-miR-4649-5p	CLIP-seq
MIRT2180705	hsa-miR-4691-5p	CLIP-seq
MIRT818142	hsa-miR-4793-3p	CLIP-seq
MIRT2180706	hsa-miR-485-5p	CLIP-seq
MIRT818144	hsa-miR-508-5p	CLIP-seq
MIRT818148	hsa-miR-548c-3p	CLIP-seq
MIRT818150	hsa-miR-548s	CLIP-seq
MIRT818152	hsa-miR-582-5p	CLIP-seq
MIRT1941840	hsa-miR-603	CLIP-seq
MIRT818154	hsa-miR-627	CLIP-seq
MIRT818155	hsa-miR-628-3p	CLIP-seq
MIRT2180707	hsa-miR-656	CLIP-seq
MIRT818156	hsa-miR-661	CLIP-seq
MIRT818157	hsa-miR-665	CLIP-seq
MIRT818158	hsa-miR-766	CLIP-seq
MIRT2180708	hsa-miR-921	CLIP-seq
MIRT818118	hsa-miR-3647-3p	CLIP-seq
MIRT818104	hsa-miR-105	CLIP-seq
MIRT2484128	hsa-miR-106a	CLIP-seq
MIRT2484129	hsa-miR-106b	CLIP-seq
MIRT2484130	hsa-miR-1179	CLIP-seq
MIRT818105	hsa-miR-1182	CLIP-seq
MIRT2484131	hsa-miR-122	CLIP-seq
MIRT818108	hsa-miR-129-5p	CLIP-seq
MIRT818109	hsa-miR-151-3p	CLIP-seq
MIRT2484132	hsa-miR-17	CLIP-seq
MIRT1545719	hsa-miR-187	CLIP-seq
MIRT2484133	hsa-miR-20a	CLIP-seq
MIRT2484134	hsa-miR-20b	CLIP-seq
MIRT2484135	hsa-miR-219-2-3p	CLIP-seq
MIRT818110	hsa-miR-2278	CLIP-seq
MIRT2484136	hsa-miR-302a	CLIP-seq
MIRT2484137	hsa-miR-302b	CLIP-seq
MIRT2484138	hsa-miR-302c	CLIP-seq
MIRT2484139	hsa-miR-302d	CLIP-seq
MIRT2484140	hsa-miR-302e	CLIP-seq
MIRT818111	hsa-miR-3121-3p	CLIP-seq
MIRT2484141	hsa-miR-3136-3p	CLIP-seq
MIRT2484142	hsa-miR-3148	CLIP-seq
MIRT2484143	hsa-miR-33a	CLIP-seq
MIRT2484144	hsa-miR-33b	CLIP-seq
MIRT2484145	hsa-miR-34a	CLIP-seq
MIRT2484146	hsa-miR-34c-5p	CLIP-seq
MIRT2484147	hsa-miR-3591-3p	CLIP-seq
MIRT2484148	hsa-miR-3613-3p	CLIP-seq
MIRT818118	hsa-miR-3647-3p	CLIP-seq
MIRT818119	hsa-miR-3671	CLIP-seq
MIRT2484149	hsa-miR-3689d	CLIP-seq
MIRT818120	hsa-miR-371-5p	CLIP-seq
MIRT818121	hsa-miR-371b-5p	CLIP-seq
MIRT2484150	hsa-miR-372	CLIP-seq
MIRT2484151	hsa-miR-373	CLIP-seq
MIRT818122	hsa-miR-384	CLIP-seq
MIRT2484152	hsa-miR-3915	CLIP-seq
MIRT2484153	hsa-miR-3925-3p	CLIP-seq
MIRT2484154	hsa-miR-3928	CLIP-seq
MIRT2180698	hsa-miR-3929	CLIP-seq
MIRT2484155	hsa-miR-3938	CLIP-seq
MIRT818124	hsa-miR-3976	CLIP-seq
MIRT818125	hsa-miR-4252	CLIP-seq
MIRT2180699	hsa-miR-4255	CLIP-seq
MIRT818127	hsa-miR-4282	CLIP-seq
MIRT2484156	hsa-miR-4311	CLIP-seq
MIRT2180702	hsa-miR-4326	CLIP-seq
MIRT2484157	hsa-miR-4328	CLIP-seq
MIRT2180703	hsa-miR-4419b	CLIP-seq
MIRT2484158	hsa-miR-4443	CLIP-seq
MIRT818131	hsa-miR-4470	CLIP-seq
MIRT1941836	hsa-miR-4474-5p	CLIP-seq
MIRT2180704	hsa-miR-4478	CLIP-seq
MIRT818132	hsa-miR-4486	CLIP-seq
MIRT2484159	hsa-miR-449a	CLIP-seq
MIRT2484160	hsa-miR-449b	CLIP-seq
MIRT818135	hsa-miR-451b	CLIP-seq
MIRT818136	hsa-miR-4635	CLIP-seq
MIRT818137	hsa-miR-4649-5p	CLIP-seq
MIRT2484161	hsa-miR-4666-5p	CLIP-seq
MIRT2484162	hsa-miR-4668-3p	CLIP-seq
MIRT818138	hsa-miR-4684-5p	CLIP-seq
MIRT2484163	hsa-miR-4687-3p	CLIP-seq
MIRT2180705	hsa-miR-4691-5p	CLIP-seq
MIRT818139	hsa-miR-4696	CLIP-seq
MIRT2484164	hsa-miR-4712-5p	CLIP-seq
MIRT818141	hsa-miR-4719	CLIP-seq
MIRT2484165	hsa-miR-4768-5p	CLIP-seq
MIRT2484166	hsa-miR-4787-3p	CLIP-seq
MIRT818142	hsa-miR-4793-3p	CLIP-seq
MIRT2180706	hsa-miR-485-5p	CLIP-seq
MIRT2484167	hsa-miR-494	CLIP-seq
MIRT2484168	hsa-miR-500a	CLIP-seq
MIRT818144	hsa-miR-508-5p	CLIP-seq
MIRT818145	hsa-miR-513a-3p	CLIP-seq
MIRT818146	hsa-miR-513c	CLIP-seq
MIRT818147	hsa-miR-514b-5p	CLIP-seq
MIRT2484169	hsa-miR-519d	CLIP-seq
MIRT2484170	hsa-miR-520a-3p	CLIP-seq
MIRT2484171	hsa-miR-520b	CLIP-seq
MIRT2484172	hsa-miR-520c-3p	CLIP-seq
MIRT2484173	hsa-miR-520d-3p	CLIP-seq
MIRT2484174	hsa-miR-520e	CLIP-seq
MIRT2484175	hsa-miR-520f	CLIP-seq
MIRT2484176	hsa-miR-548ac	CLIP-seq
MIRT2484177	hsa-miR-548ae	CLIP-seq
MIRT2484178	hsa-miR-548aj	CLIP-seq
MIRT2484179	hsa-miR-548am	CLIP-seq
MIRT818148	hsa-miR-548c-3p	CLIP-seq
MIRT2484180	hsa-miR-548d-3p	CLIP-seq
MIRT818151	hsa-miR-548u	CLIP-seq
MIRT2484181	hsa-miR-548x	CLIP-seq
MIRT2484182	hsa-miR-548z	CLIP-seq
MIRT2484183	hsa-miR-583	CLIP-seq
MIRT2484184	hsa-miR-586	CLIP-seq
MIRT1941840	hsa-miR-603	CLIP-seq
MIRT2484185	hsa-miR-607	CLIP-seq
MIRT2484186	hsa-miR-622	CLIP-seq
MIRT818155	hsa-miR-628-3p	CLIP-seq
MIRT2180707	hsa-miR-656	CLIP-seq
MIRT818156	hsa-miR-661	CLIP-seq
MIRT818158	hsa-miR-766	CLIP-seq
MIRT2484187	hsa-miR-770-5p	CLIP-seq
MIRT2484188	hsa-miR-93	CLIP-seq
MIRT818104	hsa-miR-105	CLIP-seq
MIRT2484128	hsa-miR-106a	CLIP-seq
MIRT2484129	hsa-miR-106b	CLIP-seq
MIRT2484130	hsa-miR-1179	CLIP-seq
MIRT818105	hsa-miR-1182	CLIP-seq
MIRT2484131	hsa-miR-122	CLIP-seq
MIRT818108	hsa-miR-129-5p	CLIP-seq
MIRT818109	hsa-miR-151-3p	CLIP-seq
MIRT2484132	hsa-miR-17	CLIP-seq
MIRT2484133	hsa-miR-20a	CLIP-seq
MIRT2484134	hsa-miR-20b	CLIP-seq
MIRT818110	hsa-miR-2278	CLIP-seq
MIRT2484136	hsa-miR-302a	CLIP-seq
MIRT2484137	hsa-miR-302b	CLIP-seq
MIRT2484138	hsa-miR-302c	CLIP-seq
MIRT2484139	hsa-miR-302d	CLIP-seq
MIRT2484140	hsa-miR-302e	CLIP-seq
MIRT818111	hsa-miR-3121-3p	CLIP-seq
MIRT2484141	hsa-miR-3136-3p	CLIP-seq
MIRT2484142	hsa-miR-3148	CLIP-seq
MIRT2484143	hsa-miR-33a	CLIP-seq
MIRT2484144	hsa-miR-33b	CLIP-seq
MIRT2484147	hsa-miR-3591-3p	CLIP-seq
MIRT2484148	hsa-miR-3613-3p	CLIP-seq
MIRT818118	hsa-miR-3647-3p	CLIP-seq
MIRT818119	hsa-miR-3671	CLIP-seq
MIRT2484149	hsa-miR-3689d	CLIP-seq
MIRT818120	hsa-miR-371-5p	CLIP-seq
MIRT818121	hsa-miR-371b-5p	CLIP-seq
MIRT2484150	hsa-miR-372	CLIP-seq
MIRT2484151	hsa-miR-373	CLIP-seq
MIRT818122	hsa-miR-384	CLIP-seq
MIRT2484152	hsa-miR-3915	CLIP-seq
MIRT2484153	hsa-miR-3925-3p	CLIP-seq
MIRT2484154	hsa-miR-3928	CLIP-seq
MIRT2484155	hsa-miR-3938	CLIP-seq
MIRT818124	hsa-miR-3976	CLIP-seq
MIRT818125	hsa-miR-4252	CLIP-seq
MIRT2180699	hsa-miR-4255	CLIP-seq
MIRT818127	hsa-miR-4282	CLIP-seq
MIRT2484156	hsa-miR-4311	CLIP-seq
MIRT2180702	hsa-miR-4326	CLIP-seq
MIRT2484158	hsa-miR-4443	CLIP-seq
MIRT818131	hsa-miR-4470	CLIP-seq
MIRT818132	hsa-miR-4486	CLIP-seq
MIRT818135	hsa-miR-451b	CLIP-seq
MIRT818136	hsa-miR-4635	CLIP-seq
MIRT818137	hsa-miR-4649-5p	CLIP-seq
MIRT2484161	hsa-miR-4666-5p	CLIP-seq
MIRT2484162	hsa-miR-4668-3p	CLIP-seq
MIRT818138	hsa-miR-4684-5p	CLIP-seq
MIRT2484163	hsa-miR-4687-3p	CLIP-seq
MIRT2180705	hsa-miR-4691-5p	CLIP-seq
MIRT818139	hsa-miR-4696	CLIP-seq
MIRT2484164	hsa-miR-4712-5p	CLIP-seq
MIRT818141	hsa-miR-4719	CLIP-seq
MIRT2484165	hsa-miR-4768-5p	CLIP-seq
MIRT818142	hsa-miR-4793-3p	CLIP-seq
MIRT2180706	hsa-miR-485-5p	CLIP-seq
MIRT2484167	hsa-miR-494	CLIP-seq
MIRT2484168	hsa-miR-500a	CLIP-seq
MIRT818144	hsa-miR-508-5p	CLIP-seq
MIRT818145	hsa-miR-513a-3p	CLIP-seq
MIRT818146	hsa-miR-513c	CLIP-seq
MIRT818147	hsa-miR-514b-5p	CLIP-seq
MIRT2484169	hsa-miR-519d	CLIP-seq
MIRT2484170	hsa-miR-520a-3p	CLIP-seq
MIRT2484171	hsa-miR-520b	CLIP-seq
MIRT2484172	hsa-miR-520c-3p	CLIP-seq
MIRT2484173	hsa-miR-520d-3p	CLIP-seq
MIRT2484174	hsa-miR-520e	CLIP-seq
MIRT2484175	hsa-miR-520f	CLIP-seq
MIRT2484176	hsa-miR-548ac	CLIP-seq
MIRT2484177	hsa-miR-548ae	CLIP-seq
MIRT2484178	hsa-miR-548aj	CLIP-seq
MIRT2484179	hsa-miR-548am	CLIP-seq
MIRT2484180	hsa-miR-548d-3p	CLIP-seq
MIRT818151	hsa-miR-548u	CLIP-seq
MIRT2484181	hsa-miR-548x	CLIP-seq
MIRT2484182	hsa-miR-548z	CLIP-seq
MIRT2484183	hsa-miR-583	CLIP-seq
MIRT2484184	hsa-miR-586	CLIP-seq
MIRT2484185	hsa-miR-607	CLIP-seq
MIRT2484186	hsa-miR-622	CLIP-seq
MIRT818155	hsa-miR-628-3p	CLIP-seq
MIRT818156	hsa-miR-661	CLIP-seq
MIRT818158	hsa-miR-766	CLIP-seq
MIRT2484187	hsa-miR-770-5p	CLIP-seq
MIRT2484188	hsa-miR-93	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IEA
GO:0001783	Process	B cell apoptotic process	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001843	Process	Neural tube closure	ISS	11163238
GO:0002020	Function	Protease binding	IPI	18223652
GO:0002096	Component	Polkadots	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IDA	16831874
GO:0002250	Process	Adaptive immune response	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	IMP	25365219
GO:0002250	Process	Adaptive immune response	TAS	16831874
GO:0002376	Process	Immune system process	IEA
GO:0002906	Process	Negative regulation of mature B cell apoptotic process	IDA	15878976
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	15207693
GO:0005515	Function	Protein binding	IPI	10187771, 11053425, 11259443, 11278692, 11466612, 11472070, 12154360, 14695475, 16280327, 16809782, 16831874, 17052756, 17363905, 17948050, 18287044, 19118383, 19444310, 19815501, 21157432, 22267217, 22528498, 24412244, 25011391, 25416956, 25910212, 26488816, 27070702, 27071417, 271
GO:0005634	Component	Nucleus	IDA	16280327
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11021819, 11053425, 11238466, 11278692, 15082780
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA	15082780
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	12154360, 16831874
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0006915	Process	Apoptotic process	IEA
GO:0006968	Process	Cellular defense response	IEA
GO:0009620	Process	Response to fungus	IEA
GO:0012501	Process	Programmed cell death	IDA	10400625
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0019209	Function	Kinase activator activity	IBA
GO:0019209	Function	Kinase activator activity	IDA	15125833
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	15125833
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	14695475
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16395405
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	16831874
GO:0032094	Process	Response to food	IDA	17095757
GO:0032449	Component	CBM complex	IBA
GO:0032449	Component	CBM complex	IDA	24074955, 28628108
GO:0032449	Component	CBM complex	IEA
GO:0032449	Component	CBM complex	NAS	15125833
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	NAS	16647297
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	17095757
GO:0032761	Process	Positive regulation of lymphotoxin A production	NAS	16647297
GO:0032765	Process	Positive regulation of mast cell cytokine production	NAS	16647297
GO:0032991	Component	Protein-containing complex	IDA	14695475, 16280327, 22267217
GO:0032991	Component	Protein-containing complex	IEA
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IEA
GO:0042327	Process	Positive regulation of phosphorylation	IDA	15125833
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	10187771, 25416956, 32296183
GO:0042802	Function	Identical protein binding	ISS	16831874
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	11821383
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	18223652
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	18287044, 27777308
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043422	Function	Protein kinase B binding	IBA
GO:0043422	Function	Protein kinase B binding	IPI	16280327
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IEP	16831874
GO:0045121	Component	Membrane raft	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15207693
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16127295
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050700	Function	CARD domain binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	15125833
GO:0050856	Process	Regulation of T cell receptor signaling pathway	IEA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IDA	18287044, 27777308
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0051059	Function	NF-kappaB binding	IBA
GO:0051059	Function	NF-kappaB binding	IDA	16280327
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	10400625, 14695475, 18287044, 24074955, 27777308
GO:0051260	Process	Protein homooligomerization	IDA	24074955
GO:0061760	Process	Antifungal innate immune response	IEA
GO:0061760	Process	Antifungal innate immune response	ISS
GO:0070231	Process	T cell apoptotic process	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEP	16831874
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0097190	Process	Apoptotic signaling pathway	IMP	22267217
GO:0140296	Function	General transcription initiation factor binding	IPI	15207693
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IDA	11466612
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 603517
• HGNC: 989
• e!Ensembl: ENSG00000142867

Protein

• UniProt ID: O95999
• Protein name: B-cell lymphoma/leukemia 10 (B-cell CLL/lymphoma 10) (Bcl-10) (CARD-containing molecule enhancing NF-kappa-B) (CARD-like apoptotic protein) (hCLAP) (CED-3/ICH-1 prodomain homologous E10-like regulator) (CIPER) (Cellular homolog of vCARMEN) (cCARMEN) (Cell
• Protein function: Plays a key role in both adaptive and innate immune signaling by bridging CARD domain-containing proteins to immune activation (PubMed:10187770, PubMed:10364242, PubMed:10400625, PubMed:24074955, PubMed:25365219). Acts by channeling adaptive and
• PDB: 2MB9, 6BZE, 6GK2, 8CZD, 8CZO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00619	CARD	18 → 102	Caspase recruitment domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9989495}.
• Sequence:

  MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
  SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
  SCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVG
  RTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ

• Sequence length: 233

Pathways

KEGG:

NF-kappa B signaling pathway
C-type lectin receptor signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Shigellosis
Tuberculosis

Reactome:

Activation of NF-kappaB in B cells
Downstream TCR signaling
FCERI mediated NF-kB activation
CLEC7A (Dectin-1) signaling
E3 ubiquitin ligases ubiquitinate target proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Carcinoma of colon	Pathogenic	rs387906351	RCV000023308	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Follicular lymphoma	Pathogenic	rs587776632, rs587776633, rs587776634, rs587776635, rs587776636, rs587776637	RCV000006631 RCV000006632 RCV000006633 RCV000006634 RCV000006635 RCV000006636	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Immunodeficiency 37	Pathogenic	rs606231305, rs2527119870, rs121918314, rs1660349948	RCV000148013 RCV002755111 RCV003748180 RCV003007445	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MALE GERM CELL TUMOR, SOMATIC	Pathogenic	rs387906350, rs121918314	RCV000023307 RCV000006643 RCV000006644	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant tumor of testis	Pathogenic	rs370432633	RCV000023309	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mesothelioma	Pathogenic	rs387906350, rs387906351	RCV000023306 RCV000006641	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mucosa-associated lymphoma	Pathogenic	rs387906350, rs587776630, rs587776631	RCV000006628 RCV000006629 RCV000006630	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Sezary syndrome	Pathogenic	rs587776632	RCV000006638	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
T-cell acute lymphoblastic leukemia	Pathogenic	rs387906351	RCV000006637	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BCL10-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Germ cell tumor of testis	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, B-CELL, MARGINAL ZONE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, non-Hodgkin, familial	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALT LYMPHOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma, malignant	Uncertain significance	ClinVar CTD, ClinVar	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
TESTICULAR GERM CELL TUMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10886211		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	8625322		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	8625322		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	12153171, 16785131, 17167822, 30474008		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15827331		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23530562		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36334414	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22072391		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23530562		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32900903, 37259023	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31595055		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10790217, 10845924, 10886211, 11372735, 15598810, 15878976, 16123224, 16498450, 16784987, 16957768, 22363141, 23530562, 25139387, 26277595, 26774590, 28158919, 28672935, 29102932, 29382759, 30343279, 9989495		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16785131		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	9459175		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	26890122	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18751404		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	15089759		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10582682, 16280327, 18428028, 29259013		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16280327, 32746451	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10886211, 24732096, 26771713	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10408401, 10582682, 12893071, 16136583, 8625322		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34928543	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18751404		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15156398, 16188300, 19634140, 20939431		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22564715		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22564715		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10194447, 20038611		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10583229, 29515217, 9459175		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31595055		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11920608		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10408399, 10582682, 10965024, 11041112, 11107182, 26134786		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26134786		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35352485	Associate	★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	BEFREE	25365219		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	23846624		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29515217		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	36334414	Inhibit	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10665648, 11850073, 12153171, 12692046, 16785131, 17167822, 18445693, 18755494, 19144384, 27070702, 27873317, 30474008		★☆☆☆☆ Found in Text Mining only
Diffuse Mixed-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	21684326		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11180594		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29511377		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29511377	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20939431		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11508622, 12439908, 17167836		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17167836		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29917257		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	37140617	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18497548	Associate	★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	11425462		★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	19385974		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	10582682, 11376806, 16229939		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15389288, 19861406, 31178130		★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis	Gonadal Dysgenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21115909		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10886211, 11180594, 11397650		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10665648, 10848834, 11748643, 7742524, 9021697		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11520890		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29360249		★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 37	Immunodeficiency	GENOMICS_ENGLAND_DG	25365219		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IMMUNODEFICIENCY 37	Immunodeficiency	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IMMUNODEFICIENCY 37	Immunodeficiency	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19841866, 20038611		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11687955		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15858125, 22818167		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	12389689		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	23784377		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23784377, 34879060	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23784377	Inhibit	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10886211, 10891462, 11840289		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10886211, 12139741, 12443885		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	15827331		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	10660104		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10582682, 10790217, 10873563, 11079291, 17612932, 21052098		★☆☆☆☆ Found in Text Mining only
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28672935		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10582682, 10803524, 10845924, 11113866, 11372735, 11425462, 11493468, 11748643, 11830492, 12950026, 15143341, 16395405, 16983335, 17540779, 19696203, 20235165, 22155272, 22382892, 9613974		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10845924, 11262391, 11493468, 16177990, 16636680, 23661444	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11830492, 11836626, 16775419		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10583229	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	14767488, 17295647		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Intermediate-Grade	Intermediate Grade Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell	Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11835337		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11835337		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Small Noncleaved-Cell	Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Male Germ Cell Tumor	Male Germ Cell Tumor	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21115909		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	10942247		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11107182		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18428028, 29259013		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17167836		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15156398, 16188300, 19634140		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11245486, 18413762		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18751404		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10408398, 10408399, 10408401, 10583229, 10803524, 11167747, 11406560, 12017308, 12389689, 17483317, 18843207, 21406399, 22311987, 29881386, 9989495		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22564715		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11920608		★☆☆☆☆ Found in Text Mining only
MALT lymphoma	MALT Lymphoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16280327		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10942247, 27864294		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	19174606		★☆☆☆☆ Found in Text Mining only
Mediastinal lymphadenopathy	Mediastinal lymphadenopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14572633		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	10582682, 11107182		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mesothelioma	Mesothelioma	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mouth Neoplasms	Mouth neoplasm	Pubtator	20695076	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	10319863, 10665648, 10790217, 10797525, 10845924, 10886211, 10942247, 11066079, 11079291, 11090634, 11113866, 11120333, 11372735, 11376806, 11397650, 11445840, 11493468, 11605060, 11748643, 11753078, 11830492, 11836626, 12017308, 12651604, 12841349, 12883238, 14674990, 15143341, 15540895, 15682443, 15711920, 15845895, 15878976, 16123224, 16280327, 16341151, 16395405, 16572204, 16648871, 16784987, 16917511, 17167822, 17525089, 17540779, 17852708, 18445693, 18949449, 19279678, 19696203, 20520640, 22363141, 22579587, 22842723, 23661444, 23846624, 27452667, 27873317, 30022982, 9989495		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	ORPHANET_DG	10319863, 25922601		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	11960389, 14674990, 16341151, 17199743, 18346354		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11241793, 15199411, 17483317, 20177898		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12020973		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10727459, 10886211, 15089759		★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	BEFREE	12906773		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12893071		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10219790, 10582682, 10620629, 10660104, 10665648, 10668897, 10790217, 10803524, 10942247, 11113866, 11259472, 11425462, 11605060, 11687955, 11748643, 11836626, 12017308, 12389689, 12581249, 12883238, 12885947, 15199411, 15725478, 15845895, 16917511, 17167822, 18843207, 19385974, 19634140, 20939431, 21450822, 22363141, 22474286, 22818167, 22842723, 24735610, 26134786, 27860444, 27873317, 29084984, 31178130, 8675602, 8895767, 9591537, 9625842		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25522273		★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	11376806		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	19634140		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15156398, 16188300, 22688594		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17893875		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15231651		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	23530562		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22818167		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19060244		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25384343		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10408398, 11245486, 18413762		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27071417, 27939769		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27071417	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22171132		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10408398, 11605060		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	11376806		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	10583229	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Sezary Syndrome	Sezary Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17283153, 20206622		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	12722834		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11508622, 12893071, 9591537		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11508622, 11579389, 12439908		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22513214, 25139387		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20205286	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	14523480		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	10583229		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	16229939		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29440447		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29440447	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34928543	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis, Posterior	Uveitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	21450822		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	16636680	Associate	★☆☆☆☆ Found in Text Mining only