Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8914
Gene name	Timeless circadian regulator
Gene symbol	TIMELESS
Synonyms (NCBI Gene)	FASPS4TIMTIM1hTIM
Chromosome	12
Chromosome location	12q13.3
Summary	The protein encoded by this gene is highly conserved and is involved in cell survival after damage or stress, increase in DNA polymerase epsilon activity, maintenance of telomere length, and epithelial cell morphogenesis. The encoded protein also plays a

203

Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047095	hsa-miR-183-5p	CLASH	23622248
MIRT043049	hsa-miR-324-5p	CLASH	23622248
MIRT041838	hsa-miR-484	CLASH	23622248
MIRT041838	hsa-miR-484	CLASH	23622248
MIRT039980	hsa-miR-615-3p	CLASH	23622248
MIRT036827	hsa-miR-877-3p	CLASH	23622248
MIRT036827	hsa-miR-877-3p	CLASH	23622248
MIRT036201	hsa-miR-320b	CLASH	23622248
MIRT665834	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT665833	hsa-miR-3940-3p	HITS-CLIP	23824327
MIRT665832	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT519321	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT665831	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT665830	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT665829	hsa-miR-4252	HITS-CLIP	23824327
MIRT665828	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT665827	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT665826	hsa-miR-7703	HITS-CLIP	23824327
MIRT652675	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT652674	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT652673	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT652672	hsa-miR-635	HITS-CLIP	23824327
MIRT652671	hsa-miR-6774-5p	HITS-CLIP	23824327
MIRT652670	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT652669	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT652668	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT652667	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT652666	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT652665	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT652664	hsa-miR-4507	HITS-CLIP	23824327
MIRT652663	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT519335	hsa-miR-3681-5p	PAR-CLIP	23446348
MIRT519334	hsa-miR-6849-5p	PAR-CLIP	23446348
MIRT519333	hsa-miR-1273f	PAR-CLIP	23446348
MIRT519332	hsa-miR-4683	PAR-CLIP	23446348
MIRT519330	hsa-miR-3167	PAR-CLIP	23446348
MIRT519331	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT519329	hsa-miR-4727-3p	PAR-CLIP	23446348
MIRT519328	hsa-miR-4460	PAR-CLIP	23446348
MIRT519327	hsa-miR-1270	PAR-CLIP	23446348
MIRT519326	hsa-miR-620	PAR-CLIP	23446348
MIRT519325	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT519324	hsa-miR-3591-5p	PAR-CLIP	23446348
MIRT519323	hsa-miR-3149	PAR-CLIP	23446348
MIRT519321	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT519322	hsa-miR-6748-3p	PAR-CLIP	23446348
MIRT519320	hsa-miR-4421	PAR-CLIP	23446348
MIRT519319	hsa-miR-5699-3p	PAR-CLIP	23446348
MIRT519318	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT519317	hsa-miR-3926	PAR-CLIP	23446348
MIRT519316	hsa-miR-548s	PAR-CLIP	23446348
MIRT519318	hsa-miR-3190-5p	PAR-CLIP	27292025
MIRT519317	hsa-miR-3926	PAR-CLIP	27292025
MIRT519320	hsa-miR-4421	PAR-CLIP	27292025
MIRT519316	hsa-miR-548s	PAR-CLIP	27292025
MIRT519319	hsa-miR-5699-3p	PAR-CLIP	27292025
MIRT519322	hsa-miR-6748-3p	PAR-CLIP	27292025
MIRT665834	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT665833	hsa-miR-3940-3p	HITS-CLIP	23824327
MIRT665832	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT519321	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT665831	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT665830	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT665829	hsa-miR-4252	HITS-CLIP	23824327
MIRT665828	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT665827	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT665826	hsa-miR-7703	HITS-CLIP	23824327
MIRT652675	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT652674	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT652673	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT652672	hsa-miR-635	HITS-CLIP	23824327
MIRT652671	hsa-miR-6774-5p	HITS-CLIP	23824327
MIRT652670	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT652669	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT652668	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT652667	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT652666	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT652665	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT652664	hsa-miR-4507	HITS-CLIP	23824327
MIRT652663	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT519335	hsa-miR-3681-5p	PAR-CLIP	23446348
MIRT519334	hsa-miR-6849-5p	PAR-CLIP	23446348
MIRT519333	hsa-miR-1273f	PAR-CLIP	23446348
MIRT519332	hsa-miR-4683	PAR-CLIP	23446348
MIRT519330	hsa-miR-3167	PAR-CLIP	23446348
MIRT519331	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT519329	hsa-miR-4727-3p	PAR-CLIP	23446348
MIRT519328	hsa-miR-4460	PAR-CLIP	23446348
MIRT519327	hsa-miR-1270	PAR-CLIP	23446348
MIRT519326	hsa-miR-620	PAR-CLIP	23446348
MIRT519325	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT519324	hsa-miR-3591-5p	PAR-CLIP	23446348
MIRT519323	hsa-miR-3149	PAR-CLIP	23446348
MIRT519321	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT519322	hsa-miR-6748-3p	PAR-CLIP	23446348
MIRT519320	hsa-miR-4421	PAR-CLIP	23446348
MIRT519319	hsa-miR-5699-3p	PAR-CLIP	23446348
MIRT519318	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT519317	hsa-miR-3926	PAR-CLIP	23446348
MIRT519316	hsa-miR-548s	PAR-CLIP	23446348
MIRT755388	hsa-miR-129-2-3p	Luciferase reporter assayWestern blottingqRT-PCR	37550944
MIRT1424812	hsa-miR-106a	CLIP-seq
MIRT1424813	hsa-miR-106b	CLIP-seq
MIRT1424814	hsa-miR-1197	CLIP-seq
MIRT1424815	hsa-miR-125a-3p	CLIP-seq
MIRT1424816	hsa-miR-1343	CLIP-seq
MIRT1424817	hsa-miR-150	CLIP-seq
MIRT1424818	hsa-miR-17	CLIP-seq
MIRT1424819	hsa-miR-1976	CLIP-seq
MIRT1424820	hsa-miR-20a	CLIP-seq
MIRT1424821	hsa-miR-20b	CLIP-seq
MIRT1424822	hsa-miR-302a	CLIP-seq
MIRT1424823	hsa-miR-302b	CLIP-seq
MIRT1424824	hsa-miR-302c	CLIP-seq
MIRT1424825	hsa-miR-302d	CLIP-seq
MIRT1424826	hsa-miR-302e	CLIP-seq
MIRT1424827	hsa-miR-3157-5p	CLIP-seq
MIRT1424828	hsa-miR-3192	CLIP-seq
MIRT1424829	hsa-miR-3652	CLIP-seq
MIRT1424830	hsa-miR-3681	CLIP-seq
MIRT1424831	hsa-miR-372	CLIP-seq
MIRT1424832	hsa-miR-373	CLIP-seq
MIRT1424833	hsa-miR-3934	CLIP-seq
MIRT1424834	hsa-miR-4269	CLIP-seq
MIRT1424835	hsa-miR-4279	CLIP-seq
MIRT1424836	hsa-miR-4430	CLIP-seq
MIRT1424837	hsa-miR-4438	CLIP-seq
MIRT1424838	hsa-miR-4454	CLIP-seq
MIRT1424839	hsa-miR-4499	CLIP-seq
MIRT1424840	hsa-miR-4505	CLIP-seq
MIRT1424841	hsa-miR-4506	CLIP-seq
MIRT1424842	hsa-miR-4513	CLIP-seq
MIRT1424843	hsa-miR-4514	CLIP-seq
MIRT1424844	hsa-miR-4691-3p	CLIP-seq
MIRT1424845	hsa-miR-4692	CLIP-seq
MIRT1424846	hsa-miR-4707-3p	CLIP-seq
MIRT1424847	hsa-miR-4722-3p	CLIP-seq
MIRT1424848	hsa-miR-4742-5p	CLIP-seq
MIRT1424849	hsa-miR-5095	CLIP-seq
MIRT1424850	hsa-miR-519d	CLIP-seq
MIRT1424851	hsa-miR-520a-3p	CLIP-seq
MIRT1424852	hsa-miR-520b	CLIP-seq
MIRT1424853	hsa-miR-520c-3p	CLIP-seq
MIRT1424854	hsa-miR-520d-3p	CLIP-seq
MIRT1424855	hsa-miR-520e	CLIP-seq
MIRT1424856	hsa-miR-520g	CLIP-seq
MIRT1424857	hsa-miR-520h	CLIP-seq
MIRT1424858	hsa-miR-548a-3p	CLIP-seq
MIRT1424859	hsa-miR-548ac	CLIP-seq
MIRT1424860	hsa-miR-548ae	CLIP-seq
MIRT1424861	hsa-miR-548aj	CLIP-seq
MIRT1424862	hsa-miR-548am	CLIP-seq
MIRT1424863	hsa-miR-548d-3p	CLIP-seq
MIRT1424864	hsa-miR-548e	CLIP-seq
MIRT1424865	hsa-miR-548f	CLIP-seq
MIRT1424866	hsa-miR-548u	CLIP-seq
MIRT1424867	hsa-miR-548x	CLIP-seq
MIRT1424868	hsa-miR-548z	CLIP-seq
MIRT1424869	hsa-miR-555	CLIP-seq
MIRT1424870	hsa-miR-764	CLIP-seq
MIRT1424871	hsa-miR-93	CLIP-seq
MIRT2127266	hsa-miR-1279	CLIP-seq
MIRT1424816	hsa-miR-1343	CLIP-seq
MIRT2127267	hsa-miR-198	CLIP-seq
MIRT2127268	hsa-miR-28-5p	CLIP-seq
MIRT2127269	hsa-miR-3139	CLIP-seq
MIRT2127270	hsa-miR-371-5p	CLIP-seq
MIRT2127271	hsa-miR-371b-5p	CLIP-seq
MIRT1424834	hsa-miR-4269	CLIP-seq
MIRT2127272	hsa-miR-4314	CLIP-seq
MIRT1424843	hsa-miR-4514	CLIP-seq
MIRT1424845	hsa-miR-4692	CLIP-seq
MIRT1424847	hsa-miR-4722-3p	CLIP-seq
MIRT1424848	hsa-miR-4742-5p	CLIP-seq
MIRT2127273	hsa-miR-4778-3p	CLIP-seq
MIRT2127274	hsa-miR-4796-3p	CLIP-seq
MIRT2127275	hsa-miR-486-5p	CLIP-seq
MIRT2127276	hsa-miR-548n	CLIP-seq
MIRT2127277	hsa-miR-548t	CLIP-seq
MIRT2127278	hsa-miR-708	CLIP-seq
MIRT1424816	hsa-miR-1343	CLIP-seq
MIRT1424819	hsa-miR-1976	CLIP-seq
MIRT1424829	hsa-miR-3652	CLIP-seq
MIRT1424835	hsa-miR-4279	CLIP-seq
MIRT1424836	hsa-miR-4430	CLIP-seq
MIRT1424837	hsa-miR-4438	CLIP-seq
MIRT1424840	hsa-miR-4505	CLIP-seq
MIRT1424849	hsa-miR-5095	CLIP-seq
MIRT2349108	hsa-miR-558	CLIP-seq
MIRT2127268	hsa-miR-28-5p	CLIP-seq
MIRT2127269	hsa-miR-3139	CLIP-seq
MIRT2127272	hsa-miR-4314	CLIP-seq
MIRT2127278	hsa-miR-708	CLIP-seq
MIRT1424816	hsa-miR-1343	CLIP-seq
MIRT1424834	hsa-miR-4269	CLIP-seq
MIRT1424843	hsa-miR-4514	CLIP-seq
MIRT1424845	hsa-miR-4692	CLIP-seq
MIRT1424848	hsa-miR-4742-5p	CLIP-seq
MIRT1424816	hsa-miR-1343	CLIP-seq
MIRT1424834	hsa-miR-4269	CLIP-seq
MIRT1424843	hsa-miR-4514	CLIP-seq
MIRT1424845	hsa-miR-4692	CLIP-seq
MIRT1424848	hsa-miR-4742-5p	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000076	Process	DNA replication checkpoint signaling	IBA
GO:0000785	Component	Chromatin	IDA	17102137
GO:0002009	Process	Morphogenesis of an epithelium	IEA
GO:0002009	Process	Morphogenesis of an epithelium	ISS
GO:0003677	Function	DNA binding	IBA
GO:0005515	Function	Protein binding	IPI	15798197, 17102137, 17116885, 20124417, 26344098, 30356214, 32705708, 33961781
GO:0005634	Component	Nucleus	IC	9856465
GO:0005634	Component	Nucleus	IDA	17102137
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	23797032
GO:0006974	Process	DNA damage response	ISS
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0007623	Process	Circadian rhythm	TAS	9856465
GO:0008047	Function	Enzyme activator activity	IDA	26503245
GO:0009582	Process	Detection of abiotic stimulus	TAS	9856466
GO:0030324	Process	Lung development	IEA
GO:0031297	Process	Replication fork processing	IMP	26503245
GO:0031298	Component	Replication fork protection complex	IBA
GO:0035861	Component	Site of double-strand break	IDA	26344098, 30356214
GO:0042127	Process	Regulation of cell population proliferation	IMP	17102137
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	IMP	23418588
GO:0042802	Function	Identical protein binding	IEA
GO:0043111	Process	Replication fork arrest	IBA
GO:0044770	Process	Cell cycle phase transition	IMP	17102137
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9856465
GO:0048511	Process	Rhythmic process	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0051301	Process	Cell division	IEA
GO:0072711	Process	Cellular response to hydroxyurea	IMP	23797032
GO:0072719	Process	Cellular response to cisplatin	IMP	23797032
GO:1904976	Process	Cellular response to bleomycin	IMP	23797032
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	26344098, 30356214
GO:2000781	Process	Positive regulation of double-strand break repair	IMP	23797032

MIM	HGNC	e!Ensembl
603887	11813	ENSG00000111602

Q9UNS1

Protein name

Protein timeless homolog (hTIM)

Protein function

Plays an important role in the control of DNA replication, maintenance of replication fork stability, maintenance of genome stability throughout normal DNA replication, DNA repair and in the regulation of the circadian clock (PubMed:17141802, Pu

PDB

4XHT , 4XHU , 4XHW , 5MQI , 6T9Q , 6TAZ , 7PFO , 7PLO , 8B9D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04821	TIMELESS	24 → 284	Timeless protein	Family
PF05029	TIMELESS_C	1006 → 1092	Timeless PAB domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues examined including brain, heart, lung, liver, skeletal muscle, kidney, placenta, pancreas, spleen, thymus and testis. Highest levels of expression in placenta, pancreas, thymus and testis. {ECO:0000269|PubMed:9

Sequence

MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQI
LQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAY
KEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKID
DDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQG
RLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKG
LHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGS
VKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYE
MMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRE
LFLALFRKFDERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVVQNKQKKRRKKKKKVL
DQAIVSGNVPSSPEEVEAVWPALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAM
VRIQDCLLAGQAPQALTLLRSAREVWPEGDVFGSQDISPEEEIQLLKQILSAPLPRQQGP
EERGAEEEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAH
TNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFAL
AAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLANKDV
EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRL
FEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRQKKLASSILPNGA
ESLKDFCQEDLEEEENLPEEDSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLL
WLQNCLIRAADDREEDGCSQAVPLVPLTEENEEAMENEQFQQLLRKLGVRPPASGQETFW
RIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLA
HKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY
QIEDDEDD

Sequence length

1208

Interactions

View interactions

	Reactome
			Processing of DNA double-strand break ends

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Advance sleep phase syndrome, familial, 4	Pathogenic	rs1465092391	RCV006252577	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (102)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20232767, 23406933, 23800473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	36241659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29936416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16481347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11725301, 14630400, 14637143, 15153541, 15683615, 15867855, 16938542, 17117951, 17277130, 17570927, 18727494, 19476019, 19494522, 20415862, 20727045 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	22324461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29936416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27609943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25957987, 29698674, 30590210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15565336, 16938542, 18727494, 22857392, 23406933, 24412470, 27091308, 28103916, 31044630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31644615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17239033, 18228528, 20072116, 24636202, 24716566		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	18228528, 24636202, 24716566, 31323592		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	18228528	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	16507006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25546329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14662653, 17909269, 22006848, 23725643, 24161199, 28109907, 28464854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24161199, 28464854	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29958276, 37340461, 38053143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24161199, 30249891, 35034102, 38053143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34745328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23173913, 27671527, 31138322, 31358938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	27818477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27818477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29295851		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	31800133		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24161199, 27909716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	24161199, 27909716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19476019, 19494522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26921445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30629587, 34689170, 35034102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28967680, 30230666, 30551588, 31129929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27671527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19708722, 20174623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19708722, 20174623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20174623	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	16940744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27709813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	20174623, 25957987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16159638, 16940744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	38211843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21470319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34365093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30249891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30249891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28408386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28967680, 30230666, 30551588, 31129929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	23353785, 26125859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30924565		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	26125859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	18052965, 27818477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24412470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29985717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29113224, 30526680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	21339636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	21339644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23173913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35078435	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18052965, 20140011, 21367814, 28371471, 30183357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26125859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31323592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28408386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25546329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14662653, 22006848, 23725643, 24161199, 28109907, 28464854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23173913, 31138322, 31358938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27671527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23173913, 24161199, 24336162, 26921445, 27671527, 28464854, 29113224, 30249891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24161199, 27909716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26921445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14662653, 17909269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17909269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial dysostosis	Pubtator	37129330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	19708722		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28848066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19708722, 20174623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19708722, 20174623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	10878669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19708722, 31323592		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	19708722, 20072116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15153541, 20070602, 27091308, 29141799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21454294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28583847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19424580, 22081375, 24161199, 24336162, 27413764, 27671527, 27909716, 28771750, 29399413, 31076549, 31078776, 31227543, 31669380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23173913, 31138322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28583714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	27671527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35715407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28583714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31078776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27709813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27671527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29392553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14985107, 15565336, 22290466, 22353209, 23406933, 25899833, 30730912, 31044630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	19480659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	25899833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	20174623, 25957987, 27102916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23173913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	23173913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28103916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	36241659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31323592		★★★★★ ★☆☆☆☆ Found in Text Mining only

TIMELESS (timeless circadian regulator)