ENDOU (endonuclease, poly(U) specific)

Gene

• Entrez ID: 8909
• Gene name: Endonuclease, poly(U) specific
• Gene symbol: ENDOU
• Synonyms (NCBI Gene): P11, PP11, PRSS26
• Chromosome: 12
• Chromosome location: 12q13.11
• Summary: This gene encodes a protein with endoribonuclease activity that binds polyuridine-enriched single-stranded RNA. This gene was initially characterized based on its high expression in placenta but was mischaracterized as a serine protease. In mouse, this ge

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017902	hsa-miR-335-5p	Microarray	18185580
MIRT437692	hsa-miR-27a-3p	Microarray, qRT-PCR	22815788
MIRT437700	hsa-miR-27b-3p	Microarray, qRT-PCR	22815788
MIRT448023	hsa-miR-4528	PAR-CLIP	22100165
MIRT448022	hsa-miR-4635	PAR-CLIP	22100165
MIRT448021	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT448020	hsa-miR-4452	PAR-CLIP	22100165
MIRT740106	hsa-miR-4417	HITS-CLIP	33718276
MIRT448023	hsa-miR-4528	PAR-CLIP	22100165
MIRT448022	hsa-miR-4635	PAR-CLIP	22100165
MIRT448021	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT448020	hsa-miR-4452	PAR-CLIP	22100165
MIRT963423	hsa-miR-146a	CLIP-seq
MIRT963424	hsa-miR-146b-5p	CLIP-seq
MIRT963425	hsa-miR-3150b-3p	CLIP-seq
MIRT963426	hsa-miR-4680-5p	CLIP-seq
MIRT963427	hsa-miR-4689	CLIP-seq
MIRT963428	hsa-miR-4784	CLIP-seq
MIRT963429	hsa-miR-4793-5p	CLIP-seq
MIRT963430	hsa-miR-1275	CLIP-seq
MIRT740108	hsa-miR-299-3p	CLIP-seq
MIRT740109	hsa-miR-3124-3p	CLIP-seq
MIRT963431	hsa-miR-3170	CLIP-seq
MIRT740111	hsa-miR-3675-3p	CLIP-seq
MIRT963432	hsa-miR-4264	CLIP-seq
MIRT740107	hsa-miR-4265	CLIP-seq
MIRT740104	hsa-miR-4296	CLIP-seq
MIRT740105	hsa-miR-4322	CLIP-seq
MIRT963433	hsa-miR-4525	CLIP-seq
MIRT963434	hsa-miR-4665-5p	CLIP-seq
MIRT963435	hsa-miR-4723-5p	CLIP-seq
MIRT740110	hsa-miR-4753-3p	CLIP-seq
MIRT963436	hsa-miR-4797-3p	CLIP-seq
MIRT963437	hsa-miR-625	CLIP-seq
MIRT1985568	hsa-miR-3678-3p	CLIP-seq
MIRT1985569	hsa-miR-4659a-3p	CLIP-seq
MIRT1985570	hsa-miR-4659b-3p	CLIP-seq
MIRT1985571	hsa-miR-4684-3p	CLIP-seq
MIRT1985572	hsa-miR-4778-3p	CLIP-seq
MIRT1985573	hsa-miR-578	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IDA	18936097
GO:0003723	Function	RNA binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	IBA
GO:0004521	Function	RNA endonuclease activity	IDA	18936097
GO:0004521	Function	RNA endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	IGI	37803019
GO:0004540	Function	RNA nuclease activity	IEA
GO:0005044	Function	Scavenger receptor activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	1710108
GO:0005615	Component	Extracellular space	TAS	2350438
GO:0005737	Component	Cytoplasm	IDA	6755403
GO:0005737	Component	Cytoplasm	TAS	2350438
GO:0005886	Component	Plasma membrane	TAS	1710108
GO:0006508	Process	Proteolysis	IDA	2350438
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007565	Process	Female pregnancy	IEP	2350438
GO:0008083	Function	Growth factor activity	NAS	1710108
GO:0008236	Function	Serine-type peptidase activity	IDA	18936097
GO:0008236	Function	Serine-type peptidase activity	IDA	2350438
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016441	Process	Post-transcriptional gene silencing	IGI	37803019
GO:0016787	Function	Hydrolase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0030145	Function	Manganese ion binding	TAS	18936097
GO:0030247	Function	Polysaccharide binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IGI	37803019

Other IDs

• MIM: 606720
• HGNC: 14369
• e!Ensembl: ENSG00000111405

Protein

• UniProt ID: P21128
• Protein name: Uridylate-specific endoribonuclease (EC 3.1.-.-) (EC 4.6.1.-) (Placental protein 11) (PP11) (Protein endoU)
• Protein function: Endoribonuclease that cleaves single-stranded RNAs at 5' of uridylates and releases a product with a 2',3'-cyclic phosphate at the 3'-end. The UU and GU sites are more efficiently cleaved than CU and AU sites (PubMed:18936097). Targets mRNAs to
• PDB: 9FTW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01033	Somatomedin_B	22 → 61	Somatomedin B domain	Family
  PF01033	Somatomedin_B	88 → 127	Somatomedin B domain	Family
  PF09412	XendoU	138 → 405	Endoribonuclease XendoU	Family

• Tissue specificity: TISSUE SPECIFICITY: Placental-specific, but also associated with various malignant neoplasms.
• Sequence:

  MRACISLVLAVLCGLAWAGKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTE
  DHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDF
  ESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDR
  CPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVM
  KELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFH
  NWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFAL
  YSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST

• Sequence length: 410

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	18289715		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	19815710, 31337969		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19815710, 31337969		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19380152, 21722919		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31796117	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	16400147, 17510952, 18838110, 19380152, 19702551, 20962329, 21367534, 22990943, 26821757, 27457815, 28137881, 28507317, 29550211, 30617637, 31337969		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	3971322		★☆☆☆☆ Found in Text Mining only
Hereditary liability to pressure palsies	Hereditary Liability To Pressure Palsies	BEFREE	8565626		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	31771992		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17241856		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17510952, 18838110, 19380152, 20863517, 27616678, 29334322, 29353887		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25602368		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	16400147, 17510952, 18838110, 19380152, 19702551, 20962329, 21367534, 22990943, 26821757, 27457815, 28137881, 28507317, 29550211, 30617637, 31337969		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	19380152, 20863517		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	31439839		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25602368, 31028568		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25841787		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21093564		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28137881		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	18440154, 19380152, 20863517		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17317953		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19380152		★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	8565626		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36581129	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31028568		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18838110, 19380152		★☆☆☆☆ Found in Text Mining only