Gene Gene information from NCBI Gene database.
Entrez ID 8908
Gene name Glycogenin 2
Gene symbol GYG2
Synonyms (NCBI Gene)
GN-2GN2
Chromosome X
Chromosome location Xp22.33
Summary This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glyc
miRNA miRNA information provided by mirtarbase database.
55
miRTarBase ID miRNA Experiments Reference
MIRT030406 hsa-miR-24-3p Microarray 19748357
MIRT709568 hsa-miR-4267 HITS-CLIP 19536157
MIRT709567 hsa-miR-4772-3p HITS-CLIP 19536157
MIRT709566 hsa-miR-6778-3p HITS-CLIP 19536157
MIRT709565 hsa-miR-6791-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 33961781, 35271311
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300198 4700 ENSG00000056998
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15488
Protein name Glycogenin-2 (GN-2) (GN2) (EC 2.4.1.186)
Protein function Glycogenin participates in the glycogen biosynthetic process along with glycogen synthase and glycogen branching enzyme. It catalyzes the formation of a short alpha (1,4)-glucosyl chain covalently attached via a glucose 1-O-tyrosyl linkage to in
PDB 4UEG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01501 Glyco_transf_8 39 257 Glycosyl transferase family 8 Family
Tissue specificity TISSUE SPECIFICITY: Detected in liver (at protein level) (PubMed:9857012). Expressed preferentially in liver, heart, and pancreas (PubMed:9346895). {ECO:0000269|PubMed:9346895, ECO:0000269|PubMed:9857012}.
Sequence
MSETEFHHGAQAGLELLRSSNSPTSASQSAGMTVTDQAFVTLATNDIYCQGALVLGQSLR
RHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKL
HCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHK
LLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSS
AKVVHFLGSMKPWNYKY
NPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQA
GEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPT
QIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVES
VSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGR
IDYMGKDAFARIQEKLDRFLQ
Sequence length 501
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Starch and sucrose metabolism
Metabolic pathways
  Glycogen synthesis
Glycogen storage disease type 0 (liver GYS2)
Glycogen storage disease type IV (GBE1)
Glycogen breakdown (glycogenolysis)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormality of neuronal migration Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Atypical Leigh syndrome Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GYG2-related disorder Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cardiomyopathies Cardiomyopathy BEFREE 31628455
★☆☆☆☆
Found in Text Mining only
Glycogen Storage Disease Glycogen Storage Disease GENOMICS_ENGLAND_DG 25751106
★☆☆☆☆
Found in Text Mining only
Leigh Disease Leigh Syndrome BEFREE 24100632
★☆☆☆☆
Found in Text Mining only