Gene Gene information from NCBI Gene database.
Entrez ID 8900
Gene name Cyclin A1
Gene symbol CCNA1
Synonyms (NCBI Gene)
CT146
Chromosome 13
Chromosome location 13q13.3
Summary The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
miRNA miRNA information provided by mirtarbase database.
5
miRTarBase ID miRNA Experiments Reference
MIRT006767 hsa-miR-372-3p FACSGFP reporter assayqRT-PCRWestern blot 21646351
MIRT006767 hsa-miR-372-3p FACSGFP reporter assayqRT-PCRWestern blot 21646351
MIRT018229 hsa-miR-335-5p Microarray 18185580
MIRT022823 hsa-miR-124-3p Microarray 18668037
MIRT032444 hsa-let-7b-5p Reporter assay 18379589
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Transcription factor Regulation Reference
ATF1 Repression 12044952
CREM Unknown 7760825
KDM4B Unknown 20682797
MYB Activation 10590070
MYBL2 Unknown 11264176;15922873
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0005515 Function Protein binding IPI 8756624, 15159402, 15232106, 18692475, 21540187, 25241761, 29997244, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604036 1577 ENSG00000133101
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P78396
Protein name Cyclin-A1
Protein function May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic c
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 214 340 Cyclin, N-terminal domain Domain
PF02984 Cyclin_C 342 459 Cyclin, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines. {ECO:0000269|PubMed:9041194}.
Sequence
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLT
VPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPP
AVLLLQ
Sequence length 465
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle
AMPK signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Hepatitis B
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Acute myeloid leukemia
  G0 and Early G1
Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Regulation of APC/C activators between G1/S and early anaphase
SCF(Skp2)-mediated degradation of p27/p21
Senescence-Associated Secretory Phenotype (SASP)
DNA Damage/Telomere Stress Induced Senescence
Ub-specific processing proteases
Processing of DNA double-strand break ends
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
Regulation of TP53 Activity through Phosphorylation
Regulation of TP53 Degradation
G2 Phase
Orc1 removal from chromatin
CDK-mediated phosphorylation and removal of Cdc6
G1/S-Specific Transcription
Cyclin A/B1/B2 associated events during G2/M transition
p53-Dependent G1 DNA Damage Response
Cyclin A:Cdk2-associated events at S phase entry
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 16102826, 9639417
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 31436300
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 16102826, 9639417
★☆☆☆☆
Found in Text Mining only
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 22718346, 29306020
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma Pubtator 15367334 Associate
★☆☆☆☆
Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS Atrichia With Papular Lesions BEFREE 31436300
★☆☆☆☆
Found in Text Mining only
Azoospermia Azoospermia BEFREE 19886767
★☆☆☆☆
Found in Text Mining only
Barrett Esophagus Barrett esophagus Pubtator 29343623 Associate
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 22370483
★☆☆☆☆
Found in Text Mining only
Blast Phase Blast phase chronic myelogenous leukemia BEFREE 18534064
★☆☆☆☆
Found in Text Mining only