Gene Gene information from NCBI Gene database.
Entrez ID 8887
Gene name Tax1 binding protein 1
Gene symbol TAX1BP1
Synonyms (NCBI Gene)
CALCOCO3T6BPTXBP151
Chromosome 7
Chromosome location 7p15.2
Summary This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated w
miRNA miRNA information provided by mirtarbase database.
357
miRTarBase ID miRNA Experiments Reference
MIRT020162 hsa-miR-130b-3p Sequencing 20371350
MIRT028055 hsa-miR-93-5p Sequencing 20371350
MIRT054271 hsa-miR-500a-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 25595906
MIRT054271 hsa-miR-500a-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 25595906
MIRT170891 hsa-miR-7844-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000407 Component Phagophore assembly site IEA
GO:0002376 Process Immune system process IEA
GO:0002753 Process Cytoplasmic pattern recognition receptor signaling pathway IDA 16125763, 31390091
GO:0005515 Function Protein binding IPI 10920205, 14697242, 15231748, 15474016, 17703191, 18239685, 19131965, 21765415, 21988832, 25416956, 26871637, 29892012, 30561431, 31515488, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IDA 28898289
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605326 11575 ENSG00000106052
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86VP1
Protein name Tax1-binding protein 1 (TRAF6-binding protein)
Protein function Ubiquitin-binding adapter that participates in inflammatory, antiviral and innate immune processes as well as selective autophagy regulation (PubMed:29940186, PubMed:30459273, PubMed:30909570). Plays a key role in the negative regulation of NF-k
PDB 2M7Q , 4BMJ , 4NLH , 4Z4K , 4Z4M , 5AAS , 5YT6 , 5Z7G , 8W6A , 8W6B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17751 SKICH 17 120 SKICH domain Domain
PF07888 CALCOCO1 124 417 Calcium binding and coiled-coil domain (CALCOCO1) like Coiled-coil
PF18112 Zn-C2H2_12 728 754 Autophagy receptor zinc finger-C2H2 domain Domain
PF18112 Zn-C2H2_12 755 781 Autophagy receptor zinc finger-C2H2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested.
Sequence
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTA
RDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQF

RASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVS
VTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMSE
VQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTCFLKEQLRKAE
EQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAM
KKD
QDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKK
TGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK
CKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAER
KMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRP
PVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCF
DSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTH
F
DQNVLNFD
Sequence length 789
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Mitophagy - animal
Autophagy - animal
  Regulation of TNFR1 signaling
Negative regulators of DDX58/IFIH1 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 18084325 Associate
★☆☆☆☆
Found in Text Mining only
Colitis Ulcerative Ulcerative colitis Pubtator 28842689 Inhibit
★☆☆☆☆
Found in Text Mining only
Cystic Fibrosis Cystic fibrosis Pubtator 23164641 Inhibit
★☆☆☆☆
Found in Text Mining only
Diabetic Cardiomyopathies Diabetic cardiomyopathy BEFREE 29476905
★☆☆☆☆
Found in Text Mining only
Head and Neck Carcinoma Head And Neck Carcinoma BEFREE 20549079
★☆☆☆☆
Found in Text Mining only
Head and Neck Neoplasms Head and neck neoplasm Pubtator 20549079 Associate
★☆☆☆☆
Found in Text Mining only
Hypospadias Hypospadias GWASCAT_DG 25108383
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm Head and neck cancer BEFREE 20549079
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of mouth Malignant neoplasm of mouth BEFREE 20549079
★☆☆☆☆
Found in Text Mining only