Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8881
Gene name	Cell division cycle 16
Gene symbol	CDC16
Synonyms (NCBI Gene)	ANAPC6APC6CDC16HsCUT9
Chromosome	13
Chromosome location	13q34
Summary	The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048910	hsa-miR-93-5p	CLASH	23622248
MIRT876874	hsa-miR-3674	CLIP-seq
MIRT876875	hsa-miR-3919	CLIP-seq
MIRT876876	hsa-miR-3924	CLIP-seq
MIRT876877	hsa-miR-4436b-5p	CLIP-seq
MIRT876878	hsa-miR-4756-3p	CLIP-seq
MIRT876879	hsa-miR-568	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19668213, 20360068, 21988832, 25416956, 26496610, 31515488, 32296183, 32814053, 33961781, 34595750, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	16364912, 21926987
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	7736578
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IBA
GO:0051301	Process	Cell division	IBA
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 29033132
GO:0072686	Component	Mitotic spindle	IDA	7736578
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

MIM	HGNC	e!Ensembl
603461	1720	ENSG00000130177

Q13042

Protein name

Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)

Protein function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit

PDB

3HYM , 4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12895	ANAPC3	15 → 95		Domain
PF13424	TPR_12	445 → 511		Repeat

Sequence

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST

Sequence length

620

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection		Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Juvenile	Juvenile arthritis	Pubtator	35967305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	33319642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19377877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29796162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25230976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12629511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34970268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	33319642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12029633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12029633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29796162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	40149013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33351778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDC16 (cell division cycle 16)