Gene Gene information from NCBI Gene database.
Entrez ID 8880
Gene name Far upstream element binding protein 1
Gene symbol FUBP1
Synonyms (NCBI Gene)
FBPFUBPhDH V
Chromosome 1
Chromosome location 1p31.1
Summary The protein encoded by this gene is a single stranded DNA-binding protein that binds to multiple DNA elements, including the far upstream element (FUSE) located upstream of c-myc. Binding to FUSE occurs on the non-coding strand, and is important to the re
miRNA miRNA information provided by mirtarbase database.
320
miRTarBase ID miRNA Experiments Reference
MIRT020591 hsa-miR-155-5p Proteomics 18668040
MIRT023618 hsa-miR-1-3p Proteomics 18668040
MIRT024616 hsa-miR-215-5p Microarray 19074876
MIRT026246 hsa-miR-192-5p Microarray 19074876
MIRT030728 hsa-miR-21-5p Microarray 18591254
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003697 Function Single-stranded DNA binding TAS 8125259
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603444 4004 ENSG00000162613
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96AE4
Protein name Far upstream element-binding protein 1 (FBP) (FUSE-binding protein 1) (DNA helicase V) (hDH V)
Protein function Regulates MYC expression by binding to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter. May act both as activator and repressor of transcription.
PDB 1J4W , 2KXH , 4LIJ , 6Y24 , 6Y2C , 6Y2D , 8P25
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00013 KH_1 102 166 KH domain Domain
PF00013 KH_1 187 253 KH domain Domain
PF00013 KH_1 277 341 KH domain Domain
PF00013 KH_1 378 445 KH domain Domain
PF09005 DUF1897 572 599 Domain of unknown function (DUF1897) Domain
PF09005 DUF1897 602 626 Domain of unknown function (DUF1897) Domain
Sequence
MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGY
GGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGG
EQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQ
IVEKGRPAPGFHHG
DGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGD
PYKVQQAKEMVLE
LIRDQGGFREVRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKK
IQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITD
LLRSVQAGNPGGPGPGGRG
RGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNA
DPNMKLFTIRGTPQQIDYARQLIEE
KIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTP
MGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAY
YAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAP
TGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ
Sequence length 644
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast ductal adenocarcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma Adenoma BEFREE 25030436
★☆☆☆☆
Found in Text Mining only
Adult Oligodendroglioma Oligodendroglioma BEFREE 21817013, 24117486, 25943885
★☆☆☆☆
Found in Text Mining only
Anaplastic Oligodendroglioma Anaplastic Oligodendroglioma BEFREE 23071531, 28388591
★☆☆☆☆
Found in Text Mining only
Anemia, Hemolytic Anemia BEFREE 14766013
★☆☆☆☆
Found in Text Mining only
Arthrogryposis Arthrogryposis multiplex congenita BEFREE 14766013
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 22869205
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain neoplasms Pubtator 22869205 Associate
★☆☆☆☆
Found in Text Mining only
Brain Tumor, Primary Brain Neoplasms BEFREE 22588899
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 27157613
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 32626933 Associate
★☆☆☆☆
Found in Text Mining only