SQSTM1 (sequestosome 1)

Gene

• Entrez ID: 8878
• Gene name: Sequestosome 1
• Gene symbol: SQSTM1
• Synonyms (NCBI Gene): A170, DMRV, EBIAP, FTDALS3, NADGP, OSIL, PDB3, ZIP3, p60, p62, p62B
• Chromosome: 5
• Chromosome location: 5q35.3
• Summary: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to m

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893941	C>T	Likely-pathogenic, pathogenic, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs200396166	C>G,T	Pathogenic, likely-benign	Intron variant, missense variant, coding sequence variant
rs776749939	C>T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs796051869	->T	Pathogenic	Coding sequence variant, stop gained
rs796051870	G>A	Pathogenic	Splice donor variant
rs796052213	A>T	Pathogenic	Coding sequence variant, stop gained
rs796052214	GAA>-	Uncertain-significance, pathogenic	Coding sequence variant, inframe deletion
rs886039780	T>A	Pathogenic	Initiator codon variant, intron variant, missense variant
rs886039781	AG>-	Pathogenic	Coding sequence variant, frameshift variant
rs886039782	C>T	Pathogenic	Coding sequence variant, stop gained
rs1064794783	->CGAGGCTGCGGCGGGTCCG	Not-provided, likely-pathogenic	Coding sequence variant, intron variant, frameshift variant
rs1273214757	AG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1331685476	TCTG>-	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001410	hsa-miR-16-5p	pSILAC	18668040
MIRT001410	hsa-miR-16-5p	pSILAC	18668040
MIRT018399	hsa-miR-335-5p	Microarray	18185580
MIRT025851	hsa-miR-7-5p	Microarray	19073608
MIRT001410	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT042028	hsa-miR-484	CLASH	23622248
MIRT038085	hsa-miR-423-5p	CLASH	23622248
MIRT038085	hsa-miR-423-5p	CLASH	23622248
MIRT037277	hsa-miR-877-5p	CLASH	23622248
MIRT096298	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT096299	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT096300	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT166151	hsa-miR-7161-3p	PAR-CLIP	21572407
MIRT096296	hsa-miR-646	PAR-CLIP	21572407
MIRT096302	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT166138	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT166141	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT166150	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT096305	hsa-miR-8069	PAR-CLIP	21572407
MIRT096303	hsa-miR-5093	PAR-CLIP	21572407
MIRT499049	hsa-miR-5087	PAR-CLIP	21572407
MIRT096301	hsa-miR-3978	PAR-CLIP	21572407
MIRT096298	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT096299	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT096300	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT166151	hsa-miR-7161-3p	PAR-CLIP	21572407
MIRT096296	hsa-miR-646	PAR-CLIP	21572407
MIRT096302	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT166138	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT166141	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT166150	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT096305	hsa-miR-8069	PAR-CLIP	21572407
MIRT096306	hsa-miR-8075	PAR-CLIP	21572407
MIRT096303	hsa-miR-5093	PAR-CLIP	21572407
MIRT499049	hsa-miR-5087	PAR-CLIP	21572407
MIRT096301	hsa-miR-3978	PAR-CLIP	21572407
MIRT096298	hsa-miR-548e-5p	PAR-CLIP	24398324
MIRT096299	hsa-miR-1252-3p	PAR-CLIP	24398324
MIRT096300	hsa-miR-3925-5p	PAR-CLIP	24398324
MIRT166151	hsa-miR-7161-3p	PAR-CLIP	24398324
MIRT096296	hsa-miR-646	PAR-CLIP	24398324
MIRT096302	hsa-miR-4712-3p	PAR-CLIP	24398324
MIRT166138	hsa-miR-146a-5p	PAR-CLIP	24398324
MIRT166141	hsa-miR-146b-5p	PAR-CLIP	24398324
MIRT166150	hsa-miR-7153-5p	PAR-CLIP	24398324
MIRT096305	hsa-miR-8069	PAR-CLIP	24398324
MIRT096306	hsa-miR-8075	PAR-CLIP	24398324
MIRT096303	hsa-miR-5093	PAR-CLIP	24398324
MIRT499049	hsa-miR-5087	PAR-CLIP	24398324
MIRT096301	hsa-miR-3978	PAR-CLIP	24398324
MIRT096312	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT096308	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439548	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT096312	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT096307	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT096319	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT096309	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT096329	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT096308	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439548	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT096298	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT096299	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT096300	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT166151	hsa-miR-7161-3p	PAR-CLIP	21572407
MIRT096296	hsa-miR-646	PAR-CLIP	21572407
MIRT096302	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT166138	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT166141	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT166150	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT096305	hsa-miR-8069	PAR-CLIP	21572407
MIRT096303	hsa-miR-5093	PAR-CLIP	21572407
MIRT499049	hsa-miR-5087	PAR-CLIP	21572407
MIRT096301	hsa-miR-3978	PAR-CLIP	21572407
MIRT096298	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT096299	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT096300	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT166151	hsa-miR-7161-3p	PAR-CLIP	21572407
MIRT096296	hsa-miR-646	PAR-CLIP	21572407
MIRT096302	hsa-miR-4712-3p	PAR-CLIP	21572407
MIRT166138	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT166141	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT166150	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT096305	hsa-miR-8069	PAR-CLIP	21572407
MIRT096306	hsa-miR-8075	PAR-CLIP	21572407
MIRT096303	hsa-miR-5093	PAR-CLIP	21572407
MIRT499049	hsa-miR-5087	PAR-CLIP	21572407
MIRT096301	hsa-miR-3978	PAR-CLIP	21572407
MIRT096298	hsa-miR-548e-5p	PAR-CLIP	24398324
MIRT096299	hsa-miR-1252-3p	PAR-CLIP	24398324
MIRT096300	hsa-miR-3925-5p	PAR-CLIP	24398324
MIRT166151	hsa-miR-7161-3p	PAR-CLIP	24398324
MIRT096296	hsa-miR-646	PAR-CLIP	24398324
MIRT096302	hsa-miR-4712-3p	PAR-CLIP	24398324
MIRT166138	hsa-miR-146a-5p	PAR-CLIP	24398324
MIRT166141	hsa-miR-146b-5p	PAR-CLIP	24398324
MIRT166150	hsa-miR-7153-5p	PAR-CLIP	24398324
MIRT096305	hsa-miR-8069	PAR-CLIP	24398324
MIRT096306	hsa-miR-8075	PAR-CLIP	24398324
MIRT096303	hsa-miR-5093	PAR-CLIP	24398324
MIRT499049	hsa-miR-5087	PAR-CLIP	24398324
MIRT096301	hsa-miR-3978	PAR-CLIP	24398324
MIRT1387478	hsa-miR-135a	CLIP-seq
MIRT1387479	hsa-miR-135b	CLIP-seq
MIRT1387480	hsa-miR-205	CLIP-seq
MIRT1387481	hsa-miR-2052	CLIP-seq
MIRT1387482	hsa-miR-2355-5p	CLIP-seq
MIRT1387483	hsa-miR-3065-3p	CLIP-seq
MIRT1387484	hsa-miR-3157-3p	CLIP-seq
MIRT1387485	hsa-miR-3614-5p	CLIP-seq
MIRT1387486	hsa-miR-370	CLIP-seq
MIRT1387487	hsa-miR-4261	CLIP-seq
MIRT1387488	hsa-miR-4287	CLIP-seq
MIRT1387489	hsa-miR-4496	CLIP-seq
MIRT1387490	hsa-miR-4685-3p	CLIP-seq
MIRT1387491	hsa-miR-4694-3p	CLIP-seq
MIRT1387492	hsa-miR-4757-5p	CLIP-seq
MIRT1387493	hsa-miR-4763-5p	CLIP-seq
MIRT1387494	hsa-miR-494	CLIP-seq
MIRT1387495	hsa-miR-522	CLIP-seq
MIRT1387496	hsa-miR-549	CLIP-seq
MIRT1387497	hsa-miR-596	CLIP-seq
MIRT1387498	hsa-miR-628-5p	CLIP-seq
MIRT1387499	hsa-miR-668	CLIP-seq
MIRT1387500	hsa-miR-106a	CLIP-seq
MIRT1387501	hsa-miR-106b	CLIP-seq
MIRT1387502	hsa-miR-1205	CLIP-seq
MIRT1387503	hsa-miR-1207-5p	CLIP-seq
MIRT1387504	hsa-miR-1283	CLIP-seq
MIRT1387505	hsa-miR-1321	CLIP-seq
MIRT1387506	hsa-miR-139-5p	CLIP-seq
MIRT1387507	hsa-miR-146a	CLIP-seq
MIRT1387508	hsa-miR-1587	CLIP-seq
MIRT1387509	hsa-miR-17	CLIP-seq
MIRT1387510	hsa-miR-1827	CLIP-seq
MIRT1387511	hsa-miR-1909	CLIP-seq
MIRT1387512	hsa-miR-193a-3p	CLIP-seq
MIRT1387513	hsa-miR-193a-5p	CLIP-seq
MIRT1387514	hsa-miR-193b	CLIP-seq
MIRT1387480	hsa-miR-205	CLIP-seq
MIRT1387481	hsa-miR-2052	CLIP-seq
MIRT1387515	hsa-miR-20a	CLIP-seq
MIRT1387516	hsa-miR-20b	CLIP-seq
MIRT1387482	hsa-miR-2355-5p	CLIP-seq
MIRT1387517	hsa-miR-2392	CLIP-seq
MIRT1387518	hsa-miR-298	CLIP-seq
MIRT1387519	hsa-miR-302a	CLIP-seq
MIRT1387520	hsa-miR-302b	CLIP-seq
MIRT1387521	hsa-miR-302c	CLIP-seq
MIRT1387522	hsa-miR-302d	CLIP-seq
MIRT1387523	hsa-miR-302e	CLIP-seq
MIRT1387524	hsa-miR-3184	CLIP-seq
MIRT1387525	hsa-miR-3185	CLIP-seq
MIRT1387526	hsa-miR-3189-3p	CLIP-seq
MIRT1387527	hsa-miR-3192	CLIP-seq
MIRT1387528	hsa-miR-3199	CLIP-seq
MIRT1387529	hsa-miR-3609	CLIP-seq
MIRT1387530	hsa-miR-3612	CLIP-seq
MIRT1387485	hsa-miR-3614-5p	CLIP-seq
MIRT1387531	hsa-miR-3690	CLIP-seq
MIRT1387486	hsa-miR-370	CLIP-seq
MIRT1387532	hsa-miR-3714	CLIP-seq
MIRT1387533	hsa-miR-372	CLIP-seq
MIRT1387534	hsa-miR-373	CLIP-seq
MIRT1387535	hsa-miR-3919	CLIP-seq
MIRT1387536	hsa-miR-3943	CLIP-seq
MIRT1387537	hsa-miR-4254	CLIP-seq
MIRT1387538	hsa-miR-4264	CLIP-seq
MIRT1387539	hsa-miR-4270	CLIP-seq
MIRT1387540	hsa-miR-4276	CLIP-seq
MIRT1387541	hsa-miR-4311	CLIP-seq
MIRT1387542	hsa-miR-4314	CLIP-seq
MIRT1387543	hsa-miR-4323	CLIP-seq
MIRT1387544	hsa-miR-4433	CLIP-seq
MIRT1387545	hsa-miR-4441	CLIP-seq
MIRT1387546	hsa-miR-4445	CLIP-seq
MIRT1387547	hsa-miR-4459	CLIP-seq
MIRT1387548	hsa-miR-4492	CLIP-seq
MIRT1387549	hsa-miR-4498	CLIP-seq
MIRT1387550	hsa-miR-4515	CLIP-seq
MIRT1387551	hsa-miR-4646-5p	CLIP-seq
MIRT1387552	hsa-miR-4656	CLIP-seq
MIRT1387553	hsa-miR-4660	CLIP-seq
MIRT1387554	hsa-miR-4675	CLIP-seq
MIRT1387555	hsa-miR-4688	CLIP-seq
MIRT1387556	hsa-miR-4695-5p	CLIP-seq
MIRT1387557	hsa-miR-4709-3p	CLIP-seq
MIRT1387558	hsa-miR-4728-5p	CLIP-seq
MIRT1387559	hsa-miR-4736	CLIP-seq
MIRT1387560	hsa-miR-4738-3p	CLIP-seq
MIRT1387561	hsa-miR-4739	CLIP-seq
MIRT1387562	hsa-miR-4741	CLIP-seq
MIRT1387563	hsa-miR-4756-5p	CLIP-seq
MIRT1387492	hsa-miR-4757-5p	CLIP-seq
MIRT1387564	hsa-miR-4760-5p	CLIP-seq
MIRT1387565	hsa-miR-4763-3p	CLIP-seq
MIRT1387493	hsa-miR-4763-5p	CLIP-seq
MIRT1387566	hsa-miR-4768-3p	CLIP-seq
MIRT1387567	hsa-miR-4786-5p	CLIP-seq
MIRT1387568	hsa-miR-4796-3p	CLIP-seq
MIRT1387569	hsa-miR-4797-3p	CLIP-seq
MIRT1387570	hsa-miR-4804-3p	CLIP-seq
MIRT1387571	hsa-miR-512-3p	CLIP-seq
MIRT1387572	hsa-miR-519d	CLIP-seq
MIRT1387573	hsa-miR-520a-3p	CLIP-seq
MIRT1387574	hsa-miR-520b	CLIP-seq
MIRT1387575	hsa-miR-520c-3p	CLIP-seq
MIRT1387576	hsa-miR-520d-3p	CLIP-seq
MIRT1387577	hsa-miR-520d-5p	CLIP-seq
MIRT1387578	hsa-miR-520e	CLIP-seq
MIRT1387579	hsa-miR-524-5p	CLIP-seq
MIRT1387580	hsa-miR-541	CLIP-seq
MIRT1387581	hsa-miR-548ah	CLIP-seq
MIRT1387496	hsa-miR-549	CLIP-seq
MIRT1387497	hsa-miR-596	CLIP-seq
MIRT1387582	hsa-miR-598	CLIP-seq
MIRT1387583	hsa-miR-616	CLIP-seq
MIRT1387498	hsa-miR-628-5p	CLIP-seq
MIRT1387584	hsa-miR-650	CLIP-seq
MIRT1387585	hsa-miR-654-5p	CLIP-seq
MIRT1387586	hsa-miR-657	CLIP-seq
MIRT1387587	hsa-miR-665	CLIP-seq
MIRT1387499	hsa-miR-668	CLIP-seq
MIRT1387588	hsa-miR-7	CLIP-seq
MIRT1387589	hsa-miR-762	CLIP-seq
MIRT1387590	hsa-miR-769-5p	CLIP-seq
MIRT1387591	hsa-miR-93	CLIP-seq
MIRT1387541	hsa-miR-4311	CLIP-seq
MIRT1557123	hsa-miR-4729	CLIP-seq
MIRT1387478	hsa-miR-135a	CLIP-seq
MIRT1387479	hsa-miR-135b	CLIP-seq
MIRT2116105	hsa-miR-1910	CLIP-seq
MIRT1387481	hsa-miR-2052	CLIP-seq
MIRT2116106	hsa-miR-214	CLIP-seq
MIRT1387482	hsa-miR-2355-5p	CLIP-seq
MIRT1387483	hsa-miR-3065-3p	CLIP-seq
MIRT2116107	hsa-miR-3137	CLIP-seq
MIRT1387484	hsa-miR-3157-3p	CLIP-seq
MIRT2116108	hsa-miR-3614-3p	CLIP-seq
MIRT1387485	hsa-miR-3614-5p	CLIP-seq
MIRT2116109	hsa-miR-3619-5p	CLIP-seq
MIRT1387486	hsa-miR-370	CLIP-seq
MIRT1387532	hsa-miR-3714	CLIP-seq
MIRT1387538	hsa-miR-4264	CLIP-seq
MIRT1387539	hsa-miR-4270	CLIP-seq
MIRT1387540	hsa-miR-4276	CLIP-seq
MIRT1387545	hsa-miR-4441	CLIP-seq
MIRT1387547	hsa-miR-4459	CLIP-seq
MIRT2116110	hsa-miR-4530	CLIP-seq
MIRT2116111	hsa-miR-455-3p	CLIP-seq
MIRT1387553	hsa-miR-4660	CLIP-seq
MIRT2116112	hsa-miR-4668-3p	CLIP-seq
MIRT1387491	hsa-miR-4694-3p	CLIP-seq
MIRT1387556	hsa-miR-4695-5p	CLIP-seq
MIRT2116113	hsa-miR-4754	CLIP-seq
MIRT1387492	hsa-miR-4757-5p	CLIP-seq
MIRT1387493	hsa-miR-4763-5p	CLIP-seq
MIRT1387568	hsa-miR-4796-3p	CLIP-seq
MIRT1387569	hsa-miR-4797-3p	CLIP-seq
MIRT1387495	hsa-miR-522	CLIP-seq
MIRT1387496	hsa-miR-549	CLIP-seq
MIRT1387497	hsa-miR-596	CLIP-seq
MIRT1387498	hsa-miR-628-5p	CLIP-seq
MIRT2116114	hsa-miR-645	CLIP-seq
MIRT1387499	hsa-miR-668	CLIP-seq
MIRT2116115	hsa-miR-759	CLIP-seq
MIRT2116116	hsa-miR-761	CLIP-seq
MIRT2116117	hsa-miR-938	CLIP-seq
MIRT1387500	hsa-miR-106a	CLIP-seq
MIRT1387501	hsa-miR-106b	CLIP-seq
MIRT1387504	hsa-miR-1283	CLIP-seq
MIRT1387478	hsa-miR-135a	CLIP-seq
MIRT1387479	hsa-miR-135b	CLIP-seq
MIRT1387506	hsa-miR-139-5p	CLIP-seq
MIRT2338533	hsa-miR-141	CLIP-seq
MIRT1387507	hsa-miR-146a	CLIP-seq
MIRT1387509	hsa-miR-17	CLIP-seq
MIRT1387510	hsa-miR-1827	CLIP-seq
MIRT2116105	hsa-miR-1910	CLIP-seq
MIRT1387512	hsa-miR-193a-3p	CLIP-seq
MIRT1387514	hsa-miR-193b	CLIP-seq
MIRT2338534	hsa-miR-200a	CLIP-seq
MIRT1387480	hsa-miR-205	CLIP-seq
MIRT1387481	hsa-miR-2052	CLIP-seq
MIRT1387515	hsa-miR-20a	CLIP-seq
MIRT1387516	hsa-miR-20b	CLIP-seq
MIRT2116106	hsa-miR-214	CLIP-seq
MIRT1387482	hsa-miR-2355-5p	CLIP-seq
MIRT1387517	hsa-miR-2392	CLIP-seq
MIRT1387518	hsa-miR-298	CLIP-seq
MIRT1387519	hsa-miR-302a	CLIP-seq
MIRT1387520	hsa-miR-302b	CLIP-seq
MIRT1387521	hsa-miR-302c	CLIP-seq
MIRT1387522	hsa-miR-302d	CLIP-seq
MIRT1387523	hsa-miR-302e	CLIP-seq
MIRT1387483	hsa-miR-3065-3p	CLIP-seq
MIRT2116107	hsa-miR-3137	CLIP-seq
MIRT1387484	hsa-miR-3157-3p	CLIP-seq
MIRT1387524	hsa-miR-3184	CLIP-seq
MIRT1387525	hsa-miR-3185	CLIP-seq
MIRT1387529	hsa-miR-3609	CLIP-seq
MIRT1387530	hsa-miR-3612	CLIP-seq
MIRT2116108	hsa-miR-3614-3p	CLIP-seq
MIRT1387485	hsa-miR-3614-5p	CLIP-seq
MIRT2116109	hsa-miR-3619-5p	CLIP-seq
MIRT2338535	hsa-miR-3649	CLIP-seq
MIRT1387531	hsa-miR-3690	CLIP-seq
MIRT1387486	hsa-miR-370	CLIP-seq
MIRT1387533	hsa-miR-372	CLIP-seq
MIRT1387534	hsa-miR-373	CLIP-seq
MIRT1387537	hsa-miR-4254	CLIP-seq
MIRT1387487	hsa-miR-4261	CLIP-seq
MIRT1387538	hsa-miR-4264	CLIP-seq
MIRT1387539	hsa-miR-4270	CLIP-seq
MIRT1387540	hsa-miR-4276	CLIP-seq
MIRT1387488	hsa-miR-4287	CLIP-seq
MIRT1387541	hsa-miR-4311	CLIP-seq
MIRT2338536	hsa-miR-4423-3p	CLIP-seq
MIRT1387544	hsa-miR-4433	CLIP-seq
MIRT1387545	hsa-miR-4441	CLIP-seq
MIRT1387546	hsa-miR-4445	CLIP-seq
MIRT1387547	hsa-miR-4459	CLIP-seq
MIRT1387489	hsa-miR-4496	CLIP-seq
MIRT2116110	hsa-miR-4530	CLIP-seq
MIRT2116111	hsa-miR-455-3p	CLIP-seq
MIRT2338537	hsa-miR-455-5p	CLIP-seq
MIRT1387553	hsa-miR-4660	CLIP-seq
MIRT2116112	hsa-miR-4668-3p	CLIP-seq
MIRT1387490	hsa-miR-4685-3p	CLIP-seq
MIRT1387555	hsa-miR-4688	CLIP-seq
MIRT1387491	hsa-miR-4694-3p	CLIP-seq
MIRT1387556	hsa-miR-4695-5p	CLIP-seq
MIRT1387557	hsa-miR-4709-3p	CLIP-seq
MIRT1557123	hsa-miR-4729	CLIP-seq
MIRT1387564	hsa-miR-4760-5p	CLIP-seq
MIRT1387493	hsa-miR-4763-5p	CLIP-seq
MIRT1387566	hsa-miR-4768-3p	CLIP-seq
MIRT1387567	hsa-miR-4786-5p	CLIP-seq
MIRT1387568	hsa-miR-4796-3p	CLIP-seq
MIRT1387569	hsa-miR-4797-3p	CLIP-seq
MIRT2338538	hsa-miR-4797-5p	CLIP-seq
MIRT1387570	hsa-miR-4804-3p	CLIP-seq
MIRT1387494	hsa-miR-494	CLIP-seq
MIRT1387571	hsa-miR-512-3p	CLIP-seq
MIRT1387572	hsa-miR-519d	CLIP-seq
MIRT1387573	hsa-miR-520a-3p	CLIP-seq
MIRT1387574	hsa-miR-520b	CLIP-seq
MIRT1387575	hsa-miR-520c-3p	CLIP-seq
MIRT1387576	hsa-miR-520d-3p	CLIP-seq
MIRT1387577	hsa-miR-520d-5p	CLIP-seq
MIRT1387578	hsa-miR-520e	CLIP-seq
MIRT1387495	hsa-miR-522	CLIP-seq
MIRT1387579	hsa-miR-524-5p	CLIP-seq
MIRT1387580	hsa-miR-541	CLIP-seq
MIRT1387581	hsa-miR-548ah	CLIP-seq
MIRT2338539	hsa-miR-548t	CLIP-seq
MIRT1387496	hsa-miR-549	CLIP-seq
MIRT1387497	hsa-miR-596	CLIP-seq
MIRT1387583	hsa-miR-616	CLIP-seq
MIRT1387498	hsa-miR-628-5p	CLIP-seq
MIRT2116114	hsa-miR-645	CLIP-seq
MIRT1387584	hsa-miR-650	CLIP-seq
MIRT1387585	hsa-miR-654-5p	CLIP-seq
MIRT1387587	hsa-miR-665	CLIP-seq
MIRT1387499	hsa-miR-668	CLIP-seq
MIRT2338540	hsa-miR-671-5p	CLIP-seq
MIRT1387588	hsa-miR-7	CLIP-seq
MIRT2116115	hsa-miR-759	CLIP-seq
MIRT2116116	hsa-miR-761	CLIP-seq
MIRT1387590	hsa-miR-769-5p	CLIP-seq
MIRT1387591	hsa-miR-93	CLIP-seq
MIRT2116117	hsa-miR-938	CLIP-seq
MIRT1387506	hsa-miR-139-5p	CLIP-seq
MIRT1387507	hsa-miR-146a	CLIP-seq
MIRT1387557	hsa-miR-4709-3p	CLIP-seq
MIRT1387567	hsa-miR-4786-5p	CLIP-seq
MIRT1387503	hsa-miR-1207-5p	CLIP-seq
MIRT2460517	hsa-miR-124	CLIP-seq
MIRT2460518	hsa-miR-1258	CLIP-seq
MIRT2460519	hsa-miR-154	CLIP-seq
MIRT1387481	hsa-miR-2052	CLIP-seq
MIRT1387518	hsa-miR-298	CLIP-seq
MIRT2460520	hsa-miR-3126-5p	CLIP-seq
MIRT1387484	hsa-miR-3157-3p	CLIP-seq
MIRT1387485	hsa-miR-3614-5p	CLIP-seq
MIRT2460521	hsa-miR-3664-5p	CLIP-seq
MIRT1387532	hsa-miR-3714	CLIP-seq
MIRT2460522	hsa-miR-3910	CLIP-seq
MIRT2460523	hsa-miR-4266	CLIP-seq
MIRT2460524	hsa-miR-4477a	CLIP-seq
MIRT1387556	hsa-miR-4695-5p	CLIP-seq
MIRT2460525	hsa-miR-4714-5p	CLIP-seq
MIRT1387559	hsa-miR-4736	CLIP-seq
MIRT1387565	hsa-miR-4763-3p	CLIP-seq
MIRT2460526	hsa-miR-4779	CLIP-seq
MIRT2460527	hsa-miR-506	CLIP-seq
MIRT1387580	hsa-miR-541	CLIP-seq
MIRT1387585	hsa-miR-654-5p	CLIP-seq
MIRT1387586	hsa-miR-657	CLIP-seq
MIRT1387499	hsa-miR-668	CLIP-seq
MIRT1387502	hsa-miR-1205	CLIP-seq
MIRT1387503	hsa-miR-1207-5p	CLIP-seq
MIRT2460517	hsa-miR-124	CLIP-seq
MIRT2460518	hsa-miR-1258	CLIP-seq
MIRT1387505	hsa-miR-1321	CLIP-seq
MIRT1387478	hsa-miR-135a	CLIP-seq
MIRT1387479	hsa-miR-135b	CLIP-seq
MIRT2338533	hsa-miR-141	CLIP-seq
MIRT2632051	hsa-miR-1538	CLIP-seq
MIRT2460519	hsa-miR-154	CLIP-seq
MIRT1387508	hsa-miR-1587	CLIP-seq
MIRT1387511	hsa-miR-1909	CLIP-seq
MIRT2116105	hsa-miR-1910	CLIP-seq
MIRT1387512	hsa-miR-193a-3p	CLIP-seq
MIRT1387513	hsa-miR-193a-5p	CLIP-seq
MIRT1387514	hsa-miR-193b	CLIP-seq
MIRT2338534	hsa-miR-200a	CLIP-seq
MIRT1387480	hsa-miR-205	CLIP-seq
MIRT1387481	hsa-miR-2052	CLIP-seq
MIRT2116106	hsa-miR-214	CLIP-seq
MIRT2632052	hsa-miR-2276	CLIP-seq
MIRT1387482	hsa-miR-2355-5p	CLIP-seq
MIRT1387518	hsa-miR-298	CLIP-seq
MIRT1387483	hsa-miR-3065-3p	CLIP-seq
MIRT2460520	hsa-miR-3126-5p	CLIP-seq
MIRT2116107	hsa-miR-3137	CLIP-seq
MIRT1387484	hsa-miR-3157-3p	CLIP-seq
MIRT2632053	hsa-miR-3173-5p	CLIP-seq
MIRT2632054	hsa-miR-3176	CLIP-seq
MIRT1387524	hsa-miR-3184	CLIP-seq
MIRT1387525	hsa-miR-3185	CLIP-seq
MIRT1387526	hsa-miR-3189-3p	CLIP-seq
MIRT2632055	hsa-miR-3607-3p	CLIP-seq
MIRT1387529	hsa-miR-3609	CLIP-seq
MIRT2116108	hsa-miR-3614-3p	CLIP-seq
MIRT1387485	hsa-miR-3614-5p	CLIP-seq
MIRT2116109	hsa-miR-3619-5p	CLIP-seq
MIRT2338535	hsa-miR-3649	CLIP-seq
MIRT2460521	hsa-miR-3664-5p	CLIP-seq
MIRT2632056	hsa-miR-3678-5p	CLIP-seq
MIRT2632057	hsa-miR-3686	CLIP-seq
MIRT1387531	hsa-miR-3690	CLIP-seq
MIRT1387486	hsa-miR-370	CLIP-seq
MIRT1387532	hsa-miR-3714	CLIP-seq
MIRT2632058	hsa-miR-378g	CLIP-seq
MIRT2460522	hsa-miR-3910	CLIP-seq
MIRT1387535	hsa-miR-3919	CLIP-seq
MIRT2632059	hsa-miR-3922-3p	CLIP-seq
MIRT1387536	hsa-miR-3943	CLIP-seq
MIRT1387537	hsa-miR-4254	CLIP-seq
MIRT1387487	hsa-miR-4261	CLIP-seq
MIRT1387538	hsa-miR-4264	CLIP-seq
MIRT2460523	hsa-miR-4266	CLIP-seq
MIRT1387539	hsa-miR-4270	CLIP-seq
MIRT1387488	hsa-miR-4287	CLIP-seq
MIRT1387541	hsa-miR-4311	CLIP-seq
MIRT1387543	hsa-miR-4323	CLIP-seq
MIRT2338536	hsa-miR-4423-3p	CLIP-seq
MIRT1387544	hsa-miR-4433	CLIP-seq
MIRT1387545	hsa-miR-4441	CLIP-seq
MIRT1387547	hsa-miR-4459	CLIP-seq
MIRT2460524	hsa-miR-4477a	CLIP-seq
MIRT1387548	hsa-miR-4492	CLIP-seq
MIRT1387489	hsa-miR-4496	CLIP-seq
MIRT1387549	hsa-miR-4498	CLIP-seq
MIRT2116110	hsa-miR-4530	CLIP-seq
MIRT2116111	hsa-miR-455-3p	CLIP-seq
MIRT2338537	hsa-miR-455-5p	CLIP-seq
MIRT1387552	hsa-miR-4656	CLIP-seq
MIRT2116112	hsa-miR-4668-3p	CLIP-seq
MIRT1387554	hsa-miR-4675	CLIP-seq
MIRT1387490	hsa-miR-4685-3p	CLIP-seq
MIRT2632060	hsa-miR-4685-5p	CLIP-seq
MIRT1387555	hsa-miR-4688	CLIP-seq
MIRT1387491	hsa-miR-4694-3p	CLIP-seq
MIRT1387556	hsa-miR-4695-5p	CLIP-seq
MIRT2632061	hsa-miR-4708-3p	CLIP-seq
MIRT2460525	hsa-miR-4714-5p	CLIP-seq
MIRT1387558	hsa-miR-4728-5p	CLIP-seq
MIRT1557123	hsa-miR-4729	CLIP-seq
MIRT2632062	hsa-miR-4731-5p	CLIP-seq
MIRT1387559	hsa-miR-4736	CLIP-seq
MIRT1387560	hsa-miR-4738-3p	CLIP-seq
MIRT1387561	hsa-miR-4739	CLIP-seq
MIRT1387562	hsa-miR-4741	CLIP-seq
MIRT2632063	hsa-miR-4745-3p	CLIP-seq
MIRT2116113	hsa-miR-4754	CLIP-seq
MIRT1387563	hsa-miR-4756-5p	CLIP-seq
MIRT1387492	hsa-miR-4757-5p	CLIP-seq
MIRT1387565	hsa-miR-4763-3p	CLIP-seq
MIRT1387493	hsa-miR-4763-5p	CLIP-seq
MIRT1387566	hsa-miR-4768-3p	CLIP-seq
MIRT2460526	hsa-miR-4779	CLIP-seq
MIRT1387568	hsa-miR-4796-3p	CLIP-seq
MIRT1387569	hsa-miR-4797-3p	CLIP-seq
MIRT2338538	hsa-miR-4797-5p	CLIP-seq
MIRT1387570	hsa-miR-4804-3p	CLIP-seq
MIRT1387494	hsa-miR-494	CLIP-seq
MIRT2460527	hsa-miR-506	CLIP-seq
MIRT1387495	hsa-miR-522	CLIP-seq
MIRT1387580	hsa-miR-541	CLIP-seq
MIRT1387581	hsa-miR-548ah	CLIP-seq
MIRT2338539	hsa-miR-548t	CLIP-seq
MIRT1387496	hsa-miR-549	CLIP-seq
MIRT1387497	hsa-miR-596	CLIP-seq
MIRT1387498	hsa-miR-628-5p	CLIP-seq
MIRT2116114	hsa-miR-645	CLIP-seq
MIRT1387585	hsa-miR-654-5p	CLIP-seq
MIRT1387586	hsa-miR-657	CLIP-seq
MIRT1387499	hsa-miR-668	CLIP-seq
MIRT2338540	hsa-miR-671-5p	CLIP-seq
MIRT1387588	hsa-miR-7	CLIP-seq
MIRT2116115	hsa-miR-759	CLIP-seq
MIRT2116116	hsa-miR-761	CLIP-seq
MIRT1387589	hsa-miR-762	CLIP-seq
MIRT1387590	hsa-miR-769-5p	CLIP-seq
MIRT2116117	hsa-miR-938	CLIP-seq
MIRT1387503	hsa-miR-1207-5p	CLIP-seq
MIRT2460517	hsa-miR-124	CLIP-seq
MIRT2460518	hsa-miR-1258	CLIP-seq
MIRT1387478	hsa-miR-135a	CLIP-seq
MIRT1387479	hsa-miR-135b	CLIP-seq
MIRT2632051	hsa-miR-1538	CLIP-seq
MIRT2460519	hsa-miR-154	CLIP-seq
MIRT2116105	hsa-miR-1910	CLIP-seq
MIRT1387512	hsa-miR-193a-3p	CLIP-seq
MIRT1387514	hsa-miR-193b	CLIP-seq
MIRT1387480	hsa-miR-205	CLIP-seq
MIRT1387481	hsa-miR-2052	CLIP-seq
MIRT2116106	hsa-miR-214	CLIP-seq
MIRT1387518	hsa-miR-298	CLIP-seq
MIRT2460520	hsa-miR-3126-5p	CLIP-seq
MIRT2116107	hsa-miR-3137	CLIP-seq
MIRT1387484	hsa-miR-3157-3p	CLIP-seq
MIRT1387524	hsa-miR-3184	CLIP-seq
MIRT1387525	hsa-miR-3185	CLIP-seq
MIRT1387529	hsa-miR-3609	CLIP-seq
MIRT2116108	hsa-miR-3614-3p	CLIP-seq
MIRT1387485	hsa-miR-3614-5p	CLIP-seq
MIRT2116109	hsa-miR-3619-5p	CLIP-seq
MIRT2338535	hsa-miR-3649	CLIP-seq
MIRT2632056	hsa-miR-3678-5p	CLIP-seq
MIRT1387531	hsa-miR-3690	CLIP-seq
MIRT1387532	hsa-miR-3714	CLIP-seq
MIRT2460522	hsa-miR-3910	CLIP-seq
MIRT1387535	hsa-miR-3919	CLIP-seq
MIRT1387537	hsa-miR-4254	CLIP-seq
MIRT1387538	hsa-miR-4264	CLIP-seq
MIRT2460523	hsa-miR-4266	CLIP-seq
MIRT1387539	hsa-miR-4270	CLIP-seq
MIRT1387488	hsa-miR-4287	CLIP-seq
MIRT1387541	hsa-miR-4311	CLIP-seq
MIRT1387545	hsa-miR-4441	CLIP-seq
MIRT2460524	hsa-miR-4477a	CLIP-seq
MIRT2116110	hsa-miR-4530	CLIP-seq
MIRT2116111	hsa-miR-455-3p	CLIP-seq
MIRT2116112	hsa-miR-4668-3p	CLIP-seq
MIRT1387490	hsa-miR-4685-3p	CLIP-seq
MIRT1387555	hsa-miR-4688	CLIP-seq
MIRT1387491	hsa-miR-4694-3p	CLIP-seq
MIRT1387556	hsa-miR-4695-5p	CLIP-seq
MIRT1557123	hsa-miR-4729	CLIP-seq
MIRT1387559	hsa-miR-4736	CLIP-seq
MIRT1387560	hsa-miR-4738-3p	CLIP-seq
MIRT2632063	hsa-miR-4745-3p	CLIP-seq
MIRT2116113	hsa-miR-4754	CLIP-seq
MIRT1387565	hsa-miR-4763-3p	CLIP-seq
MIRT2460526	hsa-miR-4779	CLIP-seq
MIRT1387568	hsa-miR-4796-3p	CLIP-seq
MIRT1387569	hsa-miR-4797-3p	CLIP-seq
MIRT2338538	hsa-miR-4797-5p	CLIP-seq
MIRT1387570	hsa-miR-4804-3p	CLIP-seq
MIRT2460527	hsa-miR-506	CLIP-seq
MIRT1387495	hsa-miR-522	CLIP-seq
MIRT1387580	hsa-miR-541	CLIP-seq
MIRT1387581	hsa-miR-548ah	CLIP-seq
MIRT2338539	hsa-miR-548t	CLIP-seq
MIRT1387496	hsa-miR-549	CLIP-seq
MIRT2116114	hsa-miR-645	CLIP-seq
MIRT1387585	hsa-miR-654-5p	CLIP-seq
MIRT1387586	hsa-miR-657	CLIP-seq
MIRT1387499	hsa-miR-668	CLIP-seq
MIRT2338540	hsa-miR-671-5p	CLIP-seq
MIRT1387588	hsa-miR-7	CLIP-seq
MIRT2116115	hsa-miR-759	CLIP-seq
MIRT2116116	hsa-miR-761	CLIP-seq
MIRT1387590	hsa-miR-769-5p	CLIP-seq
MIRT2116117	hsa-miR-938	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Unknown	9762895
NFKB1	Unknown	9762895
SP1	Unknown	9762895
SPDEF	Activation	12700667

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000407	Component	Phagophore assembly site	IEA
GO:0000422	Process	Autophagy of mitochondrion	NAS	20098416
GO:0000423	Process	Mitophagy	IBA
GO:0000423	Process	Mitophagy	IGI	20457763
GO:0000425	Process	Pexophagy	IDA	26344566
GO:0000932	Component	P-body	IDA	20357094
GO:0001659	Process	Temperature homeostasis	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0005080	Function	Protein kinase C binding	IBA
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	IPI	14676191
GO:0005515	Function	Protein binding	IPI	8618896, 8702753, 14676191, 16169070, 16189514, 16874300, 17389358, 17580304, 18083104, 19229298, 19250911, 19427866, 19615732, 20010802, 20168092, 20173742, 20357094, 20417604, 20452972, 20551902, 20562859, 20808283, 21149568, 21900206, 21988832, 22178386, 22190034, 22421968, 23274
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IC	31281713
GO:0005737	Component	Cytoplasm	IDA	20168092
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005776	Component	Autophagosome	IDA	30612879, 37802024
GO:0005776	Component	Autophagosome	IDA	17580304, 19640926, 20168092, 22948227, 24954904
GO:0005776	Component	Autophagosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	8650207
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	8650207
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	15572695
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	8702753
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006914	Process	Autophagy	IDA	20452972
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IMP	17580304
GO:0006914	Process	Autophagy	TAS	19816510
GO:0006915	Process	Apoptotic process	IEA
GO:0007032	Process	Endosome organization	IBA
GO:0007032	Process	Endosome organization	IDA	27368102
GO:0008104	Process	Intracellular protein localization	TAS	8650207
GO:0008270	Function	Zinc ion binding	IEA
GO:0010508	Process	Positive regulation of autophagy	IDA	28871090
GO:0010821	Process	Regulation of mitochondrion organization	NAS	20890124
GO:0016197	Process	Endosomal transport	TAS	12857745
GO:0016234	Component	Inclusion body	IDA	20168092
GO:0016234	Component	Inclusion body	IEA
GO:0016235	Component	Aggresome	IBA
GO:0016235	Component	Aggresome	IEA
GO:0016236	Process	Macroautophagy	IDA	27498865
GO:0016236	Process	Macroautophagy	IMP	20168092, 22622177
GO:0016236	Process	Macroautophagy	ISS
GO:0016605	Component	PML body	IDA	20168092
GO:0016605	Component	PML body	IEA
GO:0019899	Function	Enzyme binding	IPI	27368102
GO:0019901	Function	Protein kinase binding	IDA	8650207
GO:0030017	Component	Sarcomere	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030163	Process	Protein catabolic process	IDA	36221902
GO:0030163	Process	Protein catabolic process	IDA	27498865, 30612879, 32715615, 36221902
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	26344566, 31857589, 34893540, 37802024
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	TAS	8650207
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	20452972
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	27368102
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25127057, 27368102
GO:0033554	Process	Cellular response to stress	IDA	37802024
GO:0033554	Process	Cellular response to stress	IDA	17580304, 37802024
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	25371197
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IDA	31281713
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0035255	Function	Ionotropic glutamate receptor binding	ISS
GO:0035556	Process	Intracellular signal transduction	TAS	8650207
GO:0035973	Process	Aggrephagy	IBA
GO:0035973	Process	Aggrephagy	IDA	17580304
GO:0035973	Process	Aggrephagy	IDA	17580304, 22017874, 29343546, 29507397, 31857589, 37306101, 37802024
GO:0035973	Process	Aggrephagy	IEA
GO:0035973	Process	Aggrephagy	IPI	28404643
GO:0038023	Function	Signaling receptor activity	IDA	28871090
GO:0042169	Function	SH2 domain binding	IDA	8650207
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16169070, 20562859, 21900206, 25416956, 25686248, 32296183
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IMP	12857745
GO:0043130	Function	Ubiquitin binding	IDA	12857745
GO:0043130	Function	Ubiquitin binding	TAS
GO:0043232	Component	Intracellular membraneless organelle	IDA	22017874, 29343546, 29507397, 31857589, 37802024
GO:0043232	Component	Intracellular membraneless organelle	IEA
GO:0044753	Component	Amphisome	IBA
GO:0044753	Component	Amphisome	IDA	19640926
GO:0044754	Component	Autolysosome	IDA	19640926
GO:0044754	Component	Autolysosome	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	12857745
GO:0046578	Process	Regulation of Ras protein signal transduction	NAS	8618896
GO:0046872	Function	Metal ion binding	IEA
GO:0061635	Process	Regulation of protein complex stability	IDA	25127057
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070342	Process	Brown fat cell proliferation	IEA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IBA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IDA	28404643, 29343546
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	33799071
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	37802024
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	27498865, 34893540, 36221902, 37802024
GO:0097009	Process	Energy homeostasis	IEA
GO:0097225	Component	Sperm midpiece	IEA
GO:0097413	Component	Lewy body	IEA
GO:0098780	Process	Response to mitochondrial depolarisation	IGI	20457763
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0110076	Process	Negative regulation of ferroptosis	IMP	26403645
GO:0140036	Function	Ubiquitin-modified protein reader activity	IDA	22017874, 27498865, 31857589, 34893540, 36221902
GO:0140036	Function	Ubiquitin-modified protein reader activity	IEA
GO:0140311	Function	Protein sequestering activity	IDA	37306101
GO:0140313	Function	Molecular sequestering activity	IDA	31281713
GO:0140693	Function	Molecular condensate scaffold activity	IDA	29343546, 29507397, 31857589, 37306101, 37802024
GO:0140693	Function	Molecular condensate scaffold activity	IEA
GO:0140694	Process	Membraneless organelle assembly	IDA	29343546, 29507397, 31857589, 37802024
GO:0140694	Process	Membraneless organelle assembly	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	ISS
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	ISS
GO:1905719	Process	Protein localization to perinuclear region of cytoplasm	IDA	27368102

Other IDs

• MIM: 601530
• HGNC: 11280
• e!Ensembl: ENSG00000161011

Protein

• UniProt ID: Q13501
• Protein name: Sequestosome-1 (EBI3-associated protein of 60 kDa) (EBIAP) (p60) (Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa) (Ubiquitin-binding protein p62) (p62)
• Protein function: Molecular adapter required for selective macroautophagy (aggrephagy) by acting as a bridge between polyubiquitinated proteins and autophagosomes (PubMed:15340068, PubMed:15953362, PubMed:16286508, PubMed:17580304, PubMed:20168092, PubMed:2201787
• PDB: 1Q02, 2JY7, 2JY8, 2K0B, 2KNV, 4MJS, 4UF8, 4UF9, 5YP7, 5YP8, 5YPA, 5YPB, 5YPC, 5YPE, 5YPF, 5YPG, 5YPH, 6JM4, 6KHZ, 6MJ7, 6TGY, 6TH3, 7R1O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00564	PB1	21 → 102	PB1 domain	Domain
  PF00569	ZZ	122 → 165	Zinc finger, ZZ type	Domain
  PF16577	UBA_5	379 → 440	UBA domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:8650207}.
• Sequence:

  MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
  GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
  MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
  HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
  GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
  EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
  SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
  NYDIGAALDTIQYSKHPPPL

• Sequence length: 440

Pathways

KEGG:

Mitophagy - animal
Autophagy - animal
Necroptosis
Cellular senescence
Osteoclast differentiation
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Shigellosis
Fluid shear stress and atherosclerosis

Reactome:

NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Pink/Parkin Mediated Mitophagy
Interleukin-1 signaling
Pexophagy

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Frontotemporal dementia and/or amyotrophic lateral sclerosis 1	Pathogenic; Likely pathogenic	rs1425863340, rs1758558921, rs771966860, rs2113487920, rs2113512370, rs1391182750, rs143511494, rs2113485289, rs2480264715, rs1258386028, rs2480244186, rs2480208932, rs2113512406, rs1757759029, rs2480244231, rs796051870, rs886039782, rs373306317, rs2480199584, rs1261101487, rs2480243842, rs1758351897, rs1008679317, rs1273214757, rs1331685476, rs1185406298, rs1254158201, rs1247551175, rs1758316662	RCV001390972 RCV001381373 RCV001383720 RCV002541165 RCV001977620 RCV001949681 RCV001972785 RCV001908192 RCV003060023 RCV003090306 RCV002600639 RCV002685776 RCV002726291 RCV002780902 RCV003002562 RCV000652541 RCV001062487 RCV003792197 RCV003807918 RCV003800510 RCV003807008 RCV003804675 RCV003815257 RCV002525201 RCV001056951 RCV000795535 RCV001036644 RCV001060204 RCV001242238	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia and/or amyotrophic lateral sclerosis 3	Likely pathogenic; Pathogenic	rs143511494, rs1758359961	RCV003147715 RCV001253614	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Myopathy, distal, with rimmed vacuoles	Likely pathogenic; Pathogenic	rs143511494, rs796051870	RCV003333197 RCV001799592	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodegeneration with ataxia	Pathogenic	rs886039781	RCV004798821	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodegeneration with ataxia, dystonia, and gaze palsy, childhood-onset	Pathogenic; Likely pathogenic	rs2113487920, rs2113485292, rs1554091355, rs2480244500, rs2113510445, rs2480248364, rs886039780, rs886039781, rs886039782, rs1304560157, rs1757757569	RCV005868357 RCV001815052 RCV001815053 RCV001815054 RCV002252670 RCV002282804 RCV000256203 RCV000256191 RCV000256198 RCV003340920 RCV001264728	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ovarian serous cystadenocarcinoma	Pathogenic	rs2113485292	RCV005922656	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Paget disease of bone 2, early-onset	Pathogenic; Likely pathogenic	rs1425863340, rs1758558921, rs771966860, rs2113487920, rs2113512370, rs1391182750, rs143511494, rs2113485289, rs2480264715, rs1258386028, rs2480244186, rs2480208932, rs2113512406, rs1757759029, rs2480244231, rs796051870, rs886039782, rs373306317, rs2480199584, rs1261101487, rs2480243842, rs1758351897, rs1008679317, rs1273214757, rs1331685476, rs1185406298, rs1254158201, rs1247551175, rs1758316662	RCV001390972 RCV001381373 RCV001383720 RCV002541165 RCV001977620 RCV001949681 RCV001972785 RCV001908192 RCV003060023 RCV003090306 RCV002600639 RCV002685776 RCV002726291 RCV002780902 RCV003002562 RCV000652541 RCV001062487 RCV003792197 RCV003807918 RCV003800510 RCV003807008 RCV003804675 RCV003815257 RCV002525201 RCV001056951 RCV000795535 RCV001036644 RCV001060204 RCV001242238	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Paget disease of bone 3	Likely pathogenic; Pathogenic	rs143511494, rs796052213, rs796051869, rs796051870	RCV005370079 RCV000184064 RCV000008577 RCV000008578	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SQSTM1-related disorder	Pathogenic; Likely pathogenic	rs771966860, rs143511494, rs2480247551, rs1064794783	RCV004528496 RCV004734369 RCV004534553 RCV000509108	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SQSTM1-related multisystem proteinopathy	Likely pathogenic; Pathogenic	rs2113485289	RCV006257343	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Bone Paget disease	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL COORDINATION DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISTAL MYOPATHY, NONAKA TYPE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISTAL MYOPATHY, WELANDER TYPE	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA WITH MOTOR NEURON DISEASE	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR SKILLS DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA WITH PAGET DISEASE OF BONE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraplegia-Paget disease of bone syndrome	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WELANDER DISTAL MYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abulia	Abulia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30669574		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29974378, 31122822		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30114705		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16405664		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21613827, 22963397, 29897944, 31665193, 31810936		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26423071		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	21613827, 25050557, 30782064		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	16405664		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	36292980	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31090940		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30669574		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19557423		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	CTD_human_DG	23922739		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28055007, 29576851, 30153656, 30685605		★☆☆☆☆ Found in Text Mining only
ALK positive large B-cell lymphoma	B-cell Lymphoma	BEFREE	23588372		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19481605	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	25796131, 36516243	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	28984607	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	24162737		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	24162737		★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	29233793		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27737765, 28223223, 30235892, 31243684		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	CTD_human_DG	19765191		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22084127, 22972638, 23303844, 23417734, 23812289, 23884045, 23942205, 24042580, 24138988, 24486447, 24899140, 25114083, 25700176, 25708934, 26234378, 26302676, 26373655, 27016404, 27439389, 27545679, 27573878, 28076378, 28456633, 28490746, 29432563, 29457785, 29515358, 29653597, 29843805, 30030024, 30669930, 30867060, 30939964, 30954537, 31362587, 31525130		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	ORPHANET_DG	22084127, 23303844, 24085347, 24138988		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	22972638, 23942205, 24042580, 25114083, 25681989, 25700176, 26208961, 27156075, 27163810, 27318084, 27545679, 28490746, 29653597, 30514811, 31362587, 31861978, 33770234, 34131277, 34929165, 35034660, 35355568, 36527420, 37208601, 37243816	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	23942205	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 2, JUVENILE (disorder)	Amyotrophic lateral sclerosis	BEFREE	20339559		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	CTD_human_DG	19765191		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	BEFREE	24042580		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	CTD_human_DG	19765191		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	22084127, 24138988		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	23740229		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29153842, 31182922		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29770139		★☆☆☆☆ Found in Text Mining only
Apraxia of Phonation	Apraxia	BEFREE	25114083		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	25114083	Associate	★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26732762, 29154780, 29285070, 30451833, 30588824, 31101336		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29233793		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16874300		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	27545679, 34130600	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26732762, 29154780, 29285070, 30451833, 30588824, 31101336		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34360560	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	30114705		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	27163810	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	33159718	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23588372, 29328391, 29556265, 30133324, 31849486		★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	25114083		★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	31775562		★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	ORPHANET_DG	24042580		★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	Orphanet			★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	BEFREE	29467647		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29383752		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	30575805	Inhibit	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29048631		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17129171, 17187080	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	21515589, 29782529		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	29148034	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	31991009	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	12857745	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34130600	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12700667, 23134379, 26754771, 27345399, 27758045, 28855742, 28968743, 29103029, 29552132, 29898994, 30324661		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23026799, 28855742, 30653426, 31311202, 33213267, 35436939	Associate	★☆☆☆☆ Found in Text Mining only
Bulbar palsy	Bulbar palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	23637164		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26743088	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28498503, 30281815	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15926199, 23192274, 24086340, 28469960		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24287900, 32807131, 33712023, 34691238, 34921137, 35892599, 36028814, 36231045, 36292980	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	31180579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29048631		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31050705		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28183697, 30793399, 31637005, 31698589		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28498503	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31177911, 35354432	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31959887	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24618016, 31221127	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30653445	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28498503, 29699801, 29844838, 30081720		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	33605084	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30094720		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	9462237		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30669574		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11549587, 2574140		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8390539		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	39208097	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28006950, 28963374, 29943813		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11549587, 31183339		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	19071211, 27573878		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27545679	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23421499, 28405513, 28903368, 30275562		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31040926		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36127676	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	1874294, 2200214, 24065390, 28405513, 28544335, 30793399, 8461612		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20930850, 22652752, 27444698, 28544335, 32342935, 33076720, 39208097	Associate	★☆☆☆☆ Found in Text Mining only
Compulsive hoarding	Compulsive Hoarding	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24332042, 27031960, 30105541, 31260889		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33973626	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	29747676		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25350163, 31501480		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	23273104, 31729056		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28801211, 29434766, 30365059, 30729704		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	12727313		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16104845, 25796131, 29948344		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	36622429	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19557423		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29294366, 30260594		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29518789	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25156968, 28935571, 30401435, 31466264		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	10997688		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24492284, 29444469		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30685605		★☆☆☆☆ Found in Text Mining only
Distal Muscular Dystrophies	Distal Muscular Dystrophy	BEFREE	26208961, 29457785		★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Distal myopathy	Pubtator	26208961, 30514811	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	26208961	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy, Welander type	Distal Myopathy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	31714914, 8660983, 8792829		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	31266058		★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	Pubtator	27545679	Associate	★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyscalculia	Dyscalculia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysphasia	Dysphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	27545679	Associate	★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	30638816		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26162509, 28638475		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	28638475		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30306868, 30316442		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex Superficialis	Epidermolysis Bullosa	BEFREE	28450279		★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial expansile osteolysis	Expansile Osteolysis	BEFREE	17284635		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28419832		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27404485, 28968997, 29251796, 29276215		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	30316442, 31843092		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29414645, 30873635, 31286822		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	30298448		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	28257096		★☆☆☆☆ Found in Text Mining only
Frontotemporal cerebral atrophy	Frontotemporal cerebral atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	19481605, 24042580, 25114083, 26208961, 26234378, 26373655, 26839080, 27163810, 27545679, 27632209, 28490746, 29467647, 30030024, 30514811, 31525130		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	19481605, 24042580, 25114083, 26208961, 27163810, 27545679, 27632209, 28490746, 30514811, 33891871, 34130600, 35964197, 37243816	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	HPO_DG			★☆☆☆☆ Found in Text Mining only
FRONTOTEMPORAL DEMENTIA AND/OR AMYOTROPHIC LATERAL SCLEROSIS 3	Frontotemporal Dementia With Or Without Amyotrophic Lateral Sclerosis	CLINVAR_DG	11992264, 15493999, 18765443, 19589897, 21195346, 21515589, 23417734, 23942205, 24042580, 24899140, 25241215		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FRONTOTEMPORAL DEMENTIA AND/OR AMYOTROPHIC LATERAL SCLEROSIS 3	Frontotemporal Dementia With Or Without Amyotrophic Lateral Sclerosis	UNIPROT_DG	22084127, 24042580, 24899140, 25114083		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FRONTOTEMPORAL DEMENTIA AND/OR AMYOTROPHIC LATERAL SCLEROSIS 3	Frontotemporal Dementia With Or Without Amyotrophic Lateral Sclerosis	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal Dementia With Motor Neuron Disease	Frontotemporal Dementia With Motor Neuron Disease	CLINVAR_DG	12374763, 17129171, 23417734, 26208961, 26627873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal Dementia With Motor Neuron Disease	Frontotemporal Dementia With Motor Neuron Disease	ORPHANET_DG	24042580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal dementia with motor neuron disease	Frontotemporal Dementia With Motor Neuron Disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	22366791, 22674379, 22972638, 24252525, 24486447, 24899140, 25185840, 25433461, 27163810, 27573878, 30657305, 30954537, 31362587		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31810936		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	34484469	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	34130600	Associate	★☆☆☆☆ Found in Text Mining only
Generalized amyotrophy	Amyotrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27275741		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	27275741	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22525272, 29313411, 30718520, 31037147, 31401659, 31444413		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30718520	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22525272, 29313411, 30718520, 31037147, 31401659, 31444413		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22475378, 31444413, 31708690		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24039914, 38203743	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen storage disease	Pubtator	34130600	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	23740229		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12368243	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	31178742		★☆☆☆☆ Found in Text Mining only
Histiocytoma	Histiocytoma	BEFREE	29747676		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21954231, 25311206, 28976800, 29246658		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	34130600, 36971475	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30026731		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29171783		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24200883, 36481701	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30460641		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28968743		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19071211, 27545679, 27573878, 31107909		★☆☆☆☆ Found in Text Mining only
INCLUSION BODY MYOPATHY WITH EARLY-ONSET PAGET DISEASE AND FRONTOTEMPORAL DEMENTIA	Inclusion Body Myopathy With Paget Disease And Frontotemporal Dementia	BEFREE	16104845		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	19557423, 26335925, 27594680, 28009083, 28159418, 28318044, 31253480		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	28076378, 28794251, 29653597, 30742062		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	30790150		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	15926199		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28539120	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31802633		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30094720		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29285302		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29732938, 30675758		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	26743088, 31810986	Associate	★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	25412696		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Laryngospasm	Laryngospasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	31843092	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22898604, 27613868, 30563411	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30498063		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25034783, 39519080, 39702290	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30563411	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25034783, 30498063, 30563411		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	28406931		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	29278715		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24086340, 29439841		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	29634950		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10190901, 11549587, 12118381, 21145819, 21482715, 24287900, 24369267, 25026290, 2548435, 27211490, 27246794, 27345495, 27404485, 27845389, 28611265, 28941211, 29311600, 29707114, 29961754, 30793399, 31032410		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11549587, 31183339		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	36055749	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	26483381, 29331651		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31634464		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	27158844	Associate	★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	27275741		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26565381	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22412944, 26553068, 28183697, 30697967	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31185790		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35713446	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23588372		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29576851, 33172148	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	30503506		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12700667, 23134379, 26754771, 27345399, 27758045, 28855742, 28968743, 29103029, 29552132, 29898994, 30324661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26162509, 28638475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	24332042, 31810986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31050705		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11549587, 27404485, 28980855, 30793399		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28183697, 30793399, 31637005, 31698589		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24086340, 29439841		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28455291, 29699801, 29844838, 30081720		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21613827, 25050557		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15538718, 16405664, 25093639, 25103771, 25925890, 29368435, 29383752, 29552132, 29634950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28125038, 28724634, 30231994		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29328444, 29989092, 30043279, 30158521, 30925913		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	26707573		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29048631		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10190901, 11549587, 12118381, 16405664, 18931699, 20974803, 21613827, 22424619, 23109837, 24065390, 24121507, 24599075, 24888590, 24927592, 25093639, 27345495, 28512249, 28968743, 29088798, 29153842, 29439841, 29634950, 29699801, 29702207, 29738493, 29898994, 29928361, 30198373, 30397181, 30499183, 30654687, 30793399, 30941888, 31040926, 31182922, 31351198, 31608105		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	26707573		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23421499, 28405513, 28903368		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29786968, 31363726		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12700667		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27345399, 9840926		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	30339727		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24553345, 28715145, 29212029, 30581152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	24553345, 29212029	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	Pubtator	36292980	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28966079, 30397181		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30153656		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28715145		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29383752		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32233732	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27545679, 29938581	Associate	★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	18346206, 28429612		★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	22084127, 27016404, 27439389		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	18992722, 23637164, 24252525, 25185840		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22882088	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	BEFREE	29916295		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24971696, 26109433		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26043024, 26109433, 27626179	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	24618559		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	17784878, 17931355		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	16104845, 28009083, 29405094, 30397181, 31376301		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	27594680, 29653597	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27145374, 29030355, 30459351		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27145374, 30459351	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15926199, 1874294, 19016598, 20520551, 21613827, 2188234, 2200214, 22424619, 23192274, 24065390, 24121124, 24332042, 24475161, 24553345, 24888584, 24888590, 24927592, 25002027, 25026213, 25093639, 25925890, 26268733, 26565381, 26719575, 2679850, 27345495, 28082672, 28292022, 28405513, 28512249, 28988820, 29088798, 29103029, 29551772, 29634950, 29699801, 29702207, 29897944, 30072811, 30081720, 30198373, 30275562, 30339814, 30410612, 30713500, 30793399, 30941888, 31040926, 31659256, 31715238, 31754084, 31802896		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	30669930	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15911346, 22917563, 26509433, 28490746, 29535191		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19787053, 26509433	Associate	★☆☆☆☆ Found in Text Mining only
NEURODEGENERATION WITH ATAXIA, DYSTONIA, AND GAZE PALSY, CHILDHOOD-ONSET	Neurodegeneration With Ataxia, Dystonia, And Gaze Palsy	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEURODEGENERATION WITH ATAXIA, DYSTONIA, AND GAZE PALSY, CHILDHOOD-ONSET	Neurodegeneration With Ataxia, Dystonia, And Gaze Palsy	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEURODEGENERATION WITH ATAXIA, DYSTONIA, AND GAZE PALSY, CHILDHOOD-ONSET	Neurodegeneration With Ataxia, Dystonia, And Gaze Palsy	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17580304, 19481605, 23922739, 26008206, 27545679, 27594680, 30827875, 31362587, 31824497, 33891871, 34130600, 34987184, 35355568	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12857950, 19071211, 19481605, 19557423, 23345134, 24486447, 25311206, 26302676, 27545679, 27573878, 27594680, 28076378, 28777108, 28975445, 30143980, 30657305, 30827875, 31362587, 31525130, 31690171, 31818366		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15926199		★☆☆☆☆ Found in Text Mining only
Neuronal intranuclear inclusion disease	Neuronal Intranuclear Inclusion Disease	BEFREE	31292692		★☆☆☆☆ Found in Text Mining only
Neutropenia Nonimmune Chronic Idiopathic Adult	Neutropenia, nonimmune chronic idiopathic, adult	Pubtator	31841566	Associate	★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Paget disease of bone	Paget disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30689995		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22963397, 23769318, 29190983, 29793508, 30145802, 30237564		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	26208961		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	GENOMICS_ENGLAND_DG	26208961		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27404485, 29276215		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16517408, 28619261, 28966079, 29251796, 30588824		★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28978813		★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	31002009		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	11992264, 12374763, 12857745, 15125799, 15146436, 15164150, 15176995, 15207768, 15312251, 15365659, 15389972, 15493999, 15647816, 15765181, 16277682, 16429324, 16574459, 16691492, 16813535, 17052185, 17120186, 17129171, 17181397, 17187080, 17229006, 17229007, 17229010, 17907922, 18083707, 18379713, 18481983, 18543015, 18765443, 18984666, 19016598, 19032921, 19049332, 19257822, 19589897, 19858527, 19925894, 20061786, 20200946, 20392234, 20436471, 20499339, 20520551, 20658751, 20855225, 21073987, 21195346, 21501964, 21515589, 21735147, 21959292, 21962384, 21986510, 21987421, 22024254, 22172040, 22491873, 22543925, 22972638, 23117207, 23417734, 23612225, 23658060, 23942205, 24043712, 24138988, 24486447, 24642144, 24899140, 25115182, 25241215, 25664955, 26284446, 26713335, 26772620, 26839080, 26849110, 27163810, 27545679, 27932202, 28389692, 28524179, 28884211, 29555685, 29782529, 29907733, 29948344, 30594595, 30671590, 31036632, 31449886, 31488492		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	LHGDN	11992264, 14584883, 15493999, 16574459, 18379713, 18543015		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28801211	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	BEFREE	30740681		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28915571, 30153656		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	GENOMICS_ENGLAND_DG	12374763, 21437228		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	17229010, 19016598, 24639013, 29617702, 29928361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	19016598, 32054506	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	25093639, 29699801, 29844838, 30081720		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28455291, 28498503, 29410485, 30081720, 30941888, 36328147	Associate	★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	12374763, 15146436, 15164150, 15207768, 15389972, 16429324, 17181397, 17187080, 18765443, 18984666, 19032921, 19589897, 20392234, 21195346, 21735147, 22024254, 23417734, 23658060, 24043712, 26284446, 26713335, 29555685, 29948344, 31449886		★☆☆☆☆ Found in Text Mining only
PAGET DISEASE OF BONE 2, EARLY-ONSET	Paget disease	CLINVAR_DG	12374763, 17129171, 23417734, 26208961, 26627873		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PAGET DISEASE OF BONE 3	Paget disease	CLINVAR_DG	11992264, 15176995, 15493999, 15647816, 15765181, 16813535, 17229007, 18543015, 18765443, 19257822, 19589897, 20499339, 21195346, 21515589, 21878516, 23417734, 23942205, 24042580, 24899140, 25241215, 26713335		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PAGET DISEASE OF BONE 3	Paget disease	UNIPROT_DG	11992264, 12374763, 14584883, 15125799, 15146436, 15176995, 15207768, 19931284		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PAGET DISEASE OF BONE 3	Paget disease	GENOMICS_ENGLAND_DG	12374763, 21437228		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21613827, 25050557		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22264792		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30782064, 35354432, 36835048	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	14692700		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15926199, 19557423, 28840510, 29884186, 29989488, 30055128, 30364275, 30995872, 31501480, 31818366		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34130600	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28266109, 28266112, 28266114		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31161648		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	24042580, 25114083, 26208961, 26234378, 27163810, 30030024, 31525130		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27845161, 31256441		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31056990	Inhibit	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	19557423, 28794251, 31253480		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16104845, 25796131, 29948344		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	22098537, 28249264, 28333129, 30623621		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	28229933		★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	BEFREE	31525130		★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15538718, 16405664, 25093639, 25103771, 25925890, 29368435, 29383752, 29552132, 29634950		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24655592, 25103771, 29383752, 34987184, 35438056	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26423274	Stimulate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	38110986	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28006950		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28389259, 30977401		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	24332042, 31810986		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27031960, 30105541, 31260889		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	27466985	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29328447		★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	31342626		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15702237, 30208760, 30518408, 30538709, 31205465		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	32233732	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	26707573		★☆☆☆☆ Found in Text Mining only
Sensorineural hearing loss, bilateral	Sensorineural hearing loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27618275, 30877875		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28724634		★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 15 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	30081747	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29672276		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	25888134		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	19788049		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24086340, 27706233, 28724634, 29439841, 30134604, 30653445, 9462237		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29551772		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22882088, 24599075, 24983366, 25338734, 33318468, 34830108	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	30477228		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27467530		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24599075, 25714028		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	17543081, 30477228		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15926199, 25826083, 28086800, 28419832, 29515134		★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29328444, 29989092, 30043279, 30158521, 30472237, 30925913		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28109268, 29989092	Associate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22138392		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	24618559		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28507274, 35713446, 37175943	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28966079		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32457407, 32737449	Associate	★☆☆☆☆ Found in Text Mining only
TIBIAL MUSCULAR DYSTROPHY, TARDIVE	Tibial muscular dystrophy	BEFREE	24618559		★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	31775562		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22638807, 23328664, 30773992		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29422639		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30316442, 31843092		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31462126		★☆☆☆☆ Found in Text Mining only
Vacuolar myopathy	Vacuolar Myopathy	BEFREE	26208961		★☆☆☆☆ Found in Text Mining only
Vacuolar myopathy	Vacuolar myopathy	Pubtator	26208961	Associate	★☆☆☆☆ Found in Text Mining only
Vertical supranuclear gaze palsy	Supranuclear gaze palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	35406685	Associate	★☆☆☆☆ Found in Text Mining only
Welander Distal Myopathy	Welander Distal Myopathy	ORPHANET_DG	29457785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Welander distal myopathy, Swedish type	Welander Distal Myopathy	ORPHANET_DG	29457785		★☆☆☆☆ Found in Text Mining only
X-linked myopathy with excessive autophagy	Myopathy With Excessive Autophagy, X-Linked	BEFREE	26208961		★☆☆☆☆ Found in Text Mining only