SPHK1 (sphingosine kinase 1)

Gene

• Entrez ID: 8877
• Gene name: Sphingosine kinase 1
• Gene symbol: SPHK1
• Synonyms (NCBI Gene): SPHK
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellula

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022271	hsa-miR-124-3p	Microarray	18668037
MIRT041985	hsa-miR-484	CLASH	23622248
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24279510
MIRT022271	hsa-miR-124-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22450659
MIRT022271	hsa-miR-124-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22450659
MIRT731258	hsa-miR-506-3p	BxPC-3	27065335
MIRT731258	hsa-miR-506-3p	BxPC-3	27065335
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731258	hsa-miR-506-3p	Luciferase reporter assay and western blot	27065335
MIRT731258	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26549227
MIRT731978	hsa-miR-659-3p	Luciferase reporter assay, qRT-PCR, Western blot	27725903
MIRT731978	hsa-miR-659-3p	Luciferase reporter assay, qRT-PCR, Western blot	27725903
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28212569
MIRT735841	hsa-miR-103a-2-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31652455
MIRT736357	hsa-miR-6862-3p	Western blotting, qRT-PCR	33414358
MIRT2631202	hsa-miR-103b	CLIP-seq
MIRT2631203	hsa-miR-1229	CLIP-seq
MIRT2631204	hsa-miR-1298	CLIP-seq
MIRT2631205	hsa-miR-3176	CLIP-seq
MIRT2631206	hsa-miR-330-3p	CLIP-seq
MIRT2631207	hsa-miR-3620	CLIP-seq
MIRT2631208	hsa-miR-3922-3p	CLIP-seq
MIRT2631209	hsa-miR-3925-3p	CLIP-seq
MIRT2631210	hsa-miR-4294	CLIP-seq
MIRT2631211	hsa-miR-4422	CLIP-seq
MIRT2631212	hsa-miR-515-5p	CLIP-seq
MIRT2631213	hsa-miR-520a-5p	CLIP-seq
MIRT2631214	hsa-miR-525-5p	CLIP-seq
MIRT2631215	hsa-miR-766	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BTG2	Activation	16516161

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	10947957
GO:0001568	Process	Blood vessel development	IEA
GO:0001727	Function	Lipid kinase activity	TAS
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0003677	Function	DNA binding	IDA	12393916
GO:0005515	Function	Protein binding	IPI	12080051, 16888242, 17064696, 17124500, 18263879, 19854831, 20838377, 32814053
GO:0005516	Function	Calmodulin binding	IDA	10947957, 12393916
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IDA	12393916
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15623571, 19854831, 21075214
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS	10863092
GO:0005886	Component	Plasma membrane	IDA	19854831, 21075214
GO:0005886	Component	Plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IDA	24929359
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005929	Component	Cilium	IDA
GO:0006473	Process	Protein acetylation	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IDA	20577214
GO:0006954	Process	Inflammatory response	IEA
GO:0007420	Process	Brain development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008289	Function	Lipid binding	IDA	24929359
GO:0008481	Function	Sphingosine kinase activity	IBA
GO:0008481	Function	Sphingosine kinase activity	IDA	10863092, 11923095, 12393916, 15623571, 20577214, 21075214, 24929359, 25417698
GO:0008481	Function	Sphingosine kinase activity	IEA
GO:0008481	Function	Sphingosine kinase activity	TAS
GO:0010008	Component	Endosome membrane	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	23106337
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IDA	20577214
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016407	Function	Acetyltransferase activity	IEA
GO:0016407	Function	Acetyltransferase activity	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	10947957
GO:0030100	Process	Regulation of endocytosis	IDA	24929359, 28049734
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030139	Component	Endocytic vesicle	IEA
GO:0030139	Component	Endocytic vesicle	ISS
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030307	Process	Positive regulation of cell growth	IDA	12441135
GO:0030335	Process	Positive regulation of cell migration	IDA	12441135
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	20577214
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IDA	24929359
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0034248	Process	Regulation of amide metabolic process	IEA
GO:0034612	Process	Response to tumor necrosis factor	IDA	23935096
GO:0035556	Process	Intracellular signal transduction	TAS	10947957
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	25417698
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IMP	23106337
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15623571
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16118219
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10947957
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045202	Component	Synapse	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	12441135
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IDA	12441135
GO:0045987	Process	Positive regulation of smooth muscle contraction	IDA	12847068
GO:0046512	Process	Sphingosine biosynthetic process	IBA
GO:0046512	Process	Sphingosine biosynthetic process	IEA
GO:0046512	Process	Sphingosine biosynthetic process	IGI	23106337
GO:0046512	Process	Sphingosine biosynthetic process	IMP	23106337
GO:0046521	Process	Sphingoid catabolic process	NAS	10863092
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	15623571
GO:0050764	Process	Regulation of phagocytosis	IEA
GO:0050764	Process	Regulation of phagocytosis	ISS
GO:0051049	Process	Regulation of transport	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	20577214
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IPI	21075214
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IBA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071897	Process	DNA biosynthetic process	IEA
GO:0090520	Process	Sphingolipid mediated signaling pathway	IEA
GO:0098793	Component	Presynapse	IDA	24929359
GO:0098793	Component	Presynapse	IEA
GO:0098793	Component	Presynapse	IMP	24929359
GO:0098793	Component	Presynapse	ISS
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:1900060	Process	Negative regulation of ceramide biosynthetic process	IDA	16118219
GO:1900060	Process	Negative regulation of ceramide biosynthetic process	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	23935096
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	20577214
GO:1903978	Process	Regulation of microglial cell activation	IEA
GO:1903978	Process	Regulation of microglial cell activation	ISS
GO:1905364	Process	Regulation of endosomal vesicle fusion	IEA
GO:1905364	Process	Regulation of endosomal vesicle fusion	ISS

Other IDs

• MIM: 603730
• HGNC: 11240
• e!Ensembl: ENSG00000176170

Protein

• UniProt ID: Q9NYA1
• Protein name: Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)
• Protein function: Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such
• PDB: 3VZB, 3VZC, 3VZD, 4L02, 4V24
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00781	DAGK_cat	16 → 155	Diacylglycerol kinase catalytic domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in adult liver, kidney, heart and skeletal muscle. Expressed in brain cortex (at protein level) (PubMed:29662056). {ECO:0000269|PubMed:10802064, ECO:0000269|PubMed:29662056}.
• Sequence:

  MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
  RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
  NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
  SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
  LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
  RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
  MVSGCVEPPPSWKPQQMPPPEEPL

• Sequence length: 384

Pathways

KEGG:

Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Efferocytosis
VEGF signaling pathway
Apelin signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis

Reactome:

Sphingolipid de novo biosynthesis
Association of TriC/CCT with target proteins during biosynthesis
VEGFR2 mediated cell proliferation
Extra-nuclear estrogen signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROMES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	14729073		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15923363, 16319132, 30279138		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	16319132		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30556866		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	16357178		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18824518, 26673009		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	26673009		★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	BEFREE	30509496		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28560513		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	26673009		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24468113	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29615132, 33773368	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	30889317	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	24837436, 25587035		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30540948		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30540948		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	26673009		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	30889317		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31797978		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	19017993		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20644167, 30753812		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16508940, 19238330	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16106218		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	18980995		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31797978		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15265887		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30811821		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	30018456		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	30018456	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28386347		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25671829	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17639048, 18058224, 20110355, 20516217, 20889557, 21307639, 22298596, 23928990, 25153718, 25481644, 25482303, 27621003, 28693136, 28968647, 29207959, 29312521, 29523764, 29605826, 30226616, 30315000, 31752564		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16636149, 20110355, 20516217, 20570726, 20889557, 20926375, 22460268, 22469881, 23955546, 23981902, 24422628, 25216046, 25482303, 26842184, 27621003, 29186783, 29207959, 30726072, 31535669, 32260399, 32746988, 32810665, 33919234, 34298877, 36309544	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20335228	Inhibit	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	28231844	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19036099, 31723122, 33506044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20846391, 21936950, 26673009		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35489137	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22052326	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20066738, 25537088, 25671829, 28521610, 29360739, 31223275, 36348017, 37181808	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	30399362	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28386347		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15923363, 30352682, 30920400, 31413745		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32796926	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25805832, 33414358, 37467634	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33465049	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26716409, 28729416, 29088837, 30655321		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28587987		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28284343, 29039449		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26311741		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26311741		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26090720		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	28672103, 31809267		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	31809267	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23789924		★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	26252351		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26485657		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	19657322		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18815359, 30278948		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33980925	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22684547, 23232649, 23426175, 28583134, 29028945, 29928348, 30365116		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16319132, 28583134, 29028945		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30556866, 9823972	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22812190, 23166225, 26662312, 26937138, 28405684, 28991193, 29643998, 30154249, 30365116, 30711943, 31723122		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26662312, 26937138, 30365116, 31723122, 39930826	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	26090720		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28789830		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25589614, 25805832, 28744400, 29119970, 30524898, 30607469		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30786776		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30317247	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31652455		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30005204		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27829348		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27829348		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19617631	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26556537		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17265031, 24473437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23085271, 29108256		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31097785		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35992117	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	23658376		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21936950		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18426913		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21936950		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34533201	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	36348017	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27801960, 29572892		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	30551451		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30018456		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30018456	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	35999321	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	26252351	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16106218, 17855624, 19074142, 20938717, 24903384, 29427528		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17855624, 19074142, 19147534, 29427528, 37587449	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24903384, 26887055	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16106218, 17855624, 19074142, 20938717, 24903384, 29427528		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17376432, 17855624, 18055454, 19147534, 20335228, 22288844, 31378904	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20335228, 20938717, 21625639, 22288844		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	23789924		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	36071219	Inhibit	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20606403		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20606403	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28789830		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22761740, 32260399	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18452097		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29743513, 31068790		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17325258		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23109673, 28276483, 28789830, 29167124, 30695999, 31838904		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18055454	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22288844, 36139362	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27099350, 28789830, 29167124, 30179628, 30453304, 31713437		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23315259		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22940715, 28377281		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28377281	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26556537	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26556537		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	16980623		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	16980623		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29312521		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	28524927		★☆☆☆☆ Found in Text Mining only
LEBER CONGENITAL AMAUROSIS, TYPE II (disorder)	Leber Congenital Amaurosis	BEFREE	26684444		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	33500141	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	18283525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	26045781, 36071219	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	26252351		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27956387		★☆☆☆☆ Found in Text Mining only
Leukemia, Natural Killer Cell Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	26252351		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22098666, 23545258, 25671829, 26073327, 26549227, 26944438, 28206952, 28454397, 28521610, 29208982, 29360739, 29643998, 29844803, 30723918, 30836093, 31223275, 31749347		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26534962		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	27562371	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23545258, 26073327, 26549227, 26944438, 29208982		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24173614, 36823149	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25482303, 26842184, 30018456	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26662312, 34092610, 34533201	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27621003, 30018456		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28695300		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	23028939		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17639048, 18058224, 20110355, 20516217, 20889557, 21307639, 22298596, 23928990, 25153718, 25481644, 25482303, 27621003, 28615679, 28693136, 28968647, 29207959, 29312521, 29523764, 29605826, 30226616, 30315000, 31752564		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21936950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30018456		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19657322		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22098666, 26073327, 26549227, 29208982, 29643998		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15923363, 30352682, 30920400, 31413745		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26716409, 28729416, 29088837, 30655321		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27065335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19521959, 20959468, 22784711, 27821815, 28165392, 28615679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19228740, 20804754, 21360847, 30281914, 30791228		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21940753, 28982849		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28386347		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16414307, 17159597, 18638570, 21940753, 23109673, 23232649, 24265321, 24587339, 26252351, 26271487, 26311741, 26662312, 26944438, 27829348, 28587987, 28615679, 28695300, 28729416, 28822281, 28982849, 29078883, 29312521, 29368980, 29844803, 30018456, 30278948, 30347210, 30365116, 30463717, 30524898, 30957275, 31352240, 31620198, 31757412, 31776862, 31822735		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26311741		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18824518, 22684547, 23232649, 23426175, 28583134, 29028945, 29928348, 30365116		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	20644167		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18058224		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25153718, 25481644, 25482303, 28968647, 29351902, 29605826		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23893239, 28386327, 31412253		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30399362		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23028939		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24473437		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31363040	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34092610	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35861833	Associate	★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	17555548		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17686057	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27697999		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28560513, 28655617, 29379030		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CTD_human_DG	18283525		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17599053, 21527515		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30786776		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27811359, 28240350		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15923363, 16357178, 17555548, 18058224, 18638570, 19372554, 20516217, 21360847, 21936950, 22098666, 22298596, 22812190, 23166225, 23232649, 25589614, 25671829, 26311741, 26716409, 27956387, 28135860, 28212569, 28386347, 28454397, 28583134, 28615679, 28693136, 28729416, 28778177, 28968647, 28982849, 29207959, 29523764, 29605826, 29643998, 30281914, 30425511, 30524898, 30551451, 30556866, 30655321, 30711943, 30920400, 31097785, 31620198, 31776862		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	24434522	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17555548, 30425511		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30138818		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	28240350		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21325072, 25529771, 28231844, 30575912, 30920400, 31413745, 31423186		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19369694, 24473437		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	20516217, 20889557, 28968647		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31652455	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29377379		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	Pubtator	24336069	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22583777, 31197942		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32203055	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26716409, 28729416, 29088837, 30655321		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22594559, 32796926, 33660008, 35289120	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27065335		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33506044	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27942860, 28982849, 30551451, 31620198		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25310737	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29481916, 30138818		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19521959, 20959468, 22784711, 27821815, 28165392, 28615679		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20570726, 20926375, 23113536, 26934645, 27581969, 34656931, 35184376	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30834454		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	27099350	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28789830, 31713437		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	34133010	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26485657	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	32185202	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22615416, 23315259, 29940125		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19657322		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25589614, 28744400		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	19657322, 27799486, 29179493, 29631354, 31416077, 31632556		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24816639, 30753812		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	20846391	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20522778, 30080743, 31154460		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16751068, 25411162, 28135860, 29491060		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28364399, 30527463		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20606403, 25245676, 27160553	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20606403, 28212569, 29950445		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19228740, 20804754, 21360847, 30281914, 30791228		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18701480, 20804754, 25556479, 27384994	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25109605	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25671829	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28364200		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21940753, 28982849, 29805524		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21940753, 28982849		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21940753	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24337110, 25153718, 26857281, 29605826, 31239273		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26857281	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	24055189		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	30811821, 31606874		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24092575, 33400245, 35806446, 39367493	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	39595959	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Overactive	Overactive bladder	Pubtator	26742972	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	37725244	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34873055	Associate	★☆☆☆☆ Found in Text Mining only